1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PLBD2 Protein, Human (HEK293, His)

The PLBD2 protein is a putative phospholipase that interacts with IGF2R, suggesting a potential role in insulin-like growth factor 2 receptor-related signaling pathways. Although the enzymatic activity and functional role of PLBD2 remain to be characterized in detail, its association with IGF2R suggests involvement in cell signaling related to growth and development. PLBD2 Protein, Human (HEK293, His) is the recombinant human-derived PLBD2 protein, expressed by HEK293 , with C-His labeled tag. The total length of PLBD2 Protein, Human (HEK293, His) is 548 a.a., with molecular weight of ~80 & 45 & 32 kDa, respectively.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PLBD2 protein is a putative phospholipase that interacts with IGF2R, suggesting a potential role in insulin-like growth factor 2 receptor-related signaling pathways. Although the enzymatic activity and functional role of PLBD2 remain to be characterized in detail, its association with IGF2R suggests involvement in cell signaling related to growth and development. PLBD2 Protein, Human (HEK293, His) is the recombinant human-derived PLBD2 protein, expressed by HEK293 , with C-His labeled tag. The total length of PLBD2 Protein, Human (HEK293, His) is 548 a.a., with molecular weight of ~80 & 45 & 32 kDa, respectively.

Background

PLBD2 Protein, identified as a putative phospholipase, engages in interactions with IGF2R. Although the specific enzymatic activities and detailed functional roles of PLBD2 are yet to be fully characterized, its association with IGF2R suggests a potential involvement in cellular signaling pathways related to insulin-like growth factor 2 receptor-mediated processes. While the precise contribution of PLBD2 to cellular homeostasis and phospholipid metabolism remains unclear, its interaction with IGF2R hints at a possible connection to pathways associated with growth and development. Further research is needed to uncover the specific functions of PLBD2 and elucidate its role in cellular physiology and signaling cascades.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-10*His

Accession

Q8NHP8-1 (I42-D589)

Gene ID
Molecular Construction
N-term
PLBD2 (I42-D589)
Accession # Q8NHP8
His
C-term
Synonyms
Putative phospholipase B-like 2; p76; LAMA-like protein 2; PLBD2
AA Sequence

IPAPGGRWARDGQVPPASRSRSVLLDVSAGQLLMVDGRHPDAVAWANLTNAIRETGWAFLELGTSGQYNDSLQAYAAGVVEAAVSEELIYMHWMNTVVNYCGPFEYEVGYCERLKSFLEANLEWMQEEMESNPDSPYWHQVRLTLLQLKGLEDSYEGRVSFPAGKFTIKPLGFLLLQLSGDLEDLELALNKTKIKPSLGSGSCSALIKLLPGQSDLLVAHNTWNNYQHMLRVIKKYWLQFREGPWGDYPLVPGNKLVFSSYPGTIFSCDDFYILGSGLVTLETTIGNKNPALWKYVRPRGCVLEWVRNIVANRLASDGATWADIFKRFNSGTYNNQWMIVDYKAFIPGGPSPGSRVLTILEQIPGMVVVADKTSELYQKTYWASYNIPSFETVFNASGLQALVAQYGDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYNDFLHDPLSLCKACNPQPNGENAISARSDLNPANGSYPFQALRQRSHGGIDVKVTSMSLARILSLLAASGPTWDQVPPFQWSTSPFSGLLHMGQPDLWKFAPVKVSWD

Molecular Weight

Approximately 80 & 45 & 32 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PLBD2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PLBD2 Protein, Human (HEK293, His)
Cat. No.:
HY-P77148
Quantity:
MCE Japan Authorized Agent: