Pleiotrophin Protein, Mouse (HEK293, His)

Pleiotrophin (PTN) is a secreted growth factor that transduces signals through cell surface proteoglycan and non-proteoglycan receptors.PTN binds to chondroitin sulfate (CS) groups and regulates cell proliferation, survival, and differentiation, particularly inhibiting long-term synaptic potentiation of neurons.Pleiotrophin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Pleiotrophin protein, expressed by HEK293 , with C-6*His labeled tag.

Pleiotrophin (PTN) is a secreted growth factor that transduces its signal through both cell-surface proteoglycan and non-proteoglycan receptors. It binds to the chondroitin sulfate (CS) groups of cell-surface proteoglycan receptors, regulating crucial processes such as cell proliferation, survival, growth, differentiation, and migration in various tissues, including neurons and bone. PTN plays a pivotal role in synaptic plasticity and learning-related behavior by inhibiting long-term synaptic potentiation. Through binding to PTPRZ1, PTN neutralizes the negative charges of the CS chains, inducing PTPRZ1 clustering and subsequent inactivation of its phosphatase activity. This leads to increased tyrosine phosphorylation of PTPRZ1 substrates, such as ALK or AFAP1L2, activating the PI3K-AKT pathway. PTN also forms complexes with PTPRZ1 and integrin alpha-V/beta-3, stimulating endothelial cell migration. In the adult hippocampus, PTN promotes dendritic arborization, spine development, and functional integration of newborn granule neurons through ALK and AKT signaling. Additionally, PTN interacts with GPC2, SDC3, and other receptors, mediating diverse functions related to bone formation, neural stem cell proliferation and differentiation, hematopoietic regeneration, and various physiological processes in the female reproductive system and auditory response. The intricate network of PTN interactions underscores its multifaceted role in cellular and tissue-level regulatory mechanisms.

Measured in a cell proliferation assay using SH-SY5Y cells. The ED₅₀ for this effect is 5.024 μg/mL.

• 
  Measured in a cell proliferation assay using SH-SY5Y cells. The ED₅₀ for this effect is 5.024 μg/mL, corresponding to a specific activity is 199.045 units/mg.

Mouse

HEK293

C-6*His

P63089 (G33-D168)

19242  [NCBI]

GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNADCQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD

Approximately 19.0 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.