1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Pleiotrophin Protein, Mouse (HEK293, His)

Pleiotrophin (PTN) is a secreted growth factor that transduces signals through cell surface proteoglycan and non-proteoglycan receptors.PTN binds to chondroitin sulfate (CS) groups and regulates cell proliferation, survival, and differentiation, particularly inhibiting long-term synaptic potentiation of neurons.Pleiotrophin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Pleiotrophin protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Pleiotrophin Protein, Mouse (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Pleiotrophin (PTN) is a secreted growth factor that transduces signals through cell surface proteoglycan and non-proteoglycan receptors.PTN binds to chondroitin sulfate (CS) groups and regulates cell proliferation, survival, and differentiation, particularly inhibiting long-term synaptic potentiation of neurons.Pleiotrophin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Pleiotrophin protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Pleiotrophin (PTN) is a secreted growth factor that transduces its signal through both cell-surface proteoglycan and non-proteoglycan receptors. It binds to the chondroitin sulfate (CS) groups of cell-surface proteoglycan receptors, regulating crucial processes such as cell proliferation, survival, growth, differentiation, and migration in various tissues, including neurons and bone. PTN plays a pivotal role in synaptic plasticity and learning-related behavior by inhibiting long-term synaptic potentiation. Through binding to PTPRZ1, PTN neutralizes the negative charges of the CS chains, inducing PTPRZ1 clustering and subsequent inactivation of its phosphatase activity. This leads to increased tyrosine phosphorylation of PTPRZ1 substrates, such as ALK or AFAP1L2, activating the PI3K-AKT pathway. PTN also forms complexes with PTPRZ1 and integrin alpha-V/beta-3, stimulating endothelial cell migration. In the adult hippocampus, PTN promotes dendritic arborization, spine development, and functional integration of newborn granule neurons through ALK and AKT signaling. Additionally, PTN interacts with GPC2, SDC3, and other receptors, mediating diverse functions related to bone formation, neural stem cell proliferation and differentiation, hematopoietic regeneration, and various physiological processes in the female reproductive system and auditory response. The intricate network of PTN interactions underscores its multifaceted role in cellular and tissue-level regulatory mechanisms.

Biological Activity

Measured in a cell proliferation assay using SH-SY5Y cells. The ED50 for this effect is 5.024 μg/mL.

  • Measured in a cell proliferation assay using SH-SY5Y cells. The ED50 for this effect is 5.024 μg/mL, corresponding to a specific activity is 199.045 units/mg.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P63089 (G33-D168)

Gene ID
Molecular Construction
N-term
Pleiotrophin (G33-D168)
Accession # P63089
6*His
C-term
Synonyms
Pleiotrophin; PTN; Heparin-binding brain mitogen; HBBM; Heparin-binding growth factor 8; HBGF-8; Osteoblast-specific factor 1; OSF-1;
AA Sequence

GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNADCQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD

Molecular Weight

Approximately 19.0 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Pleiotrophin Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Pleiotrophin Protein, Mouse (HEK293, His)
Cat. No.:
HY-P71213
Quantity:
MCE Japan Authorized Agent: