1. Recombinant Proteins
  2. Others
  3. PLXDC2 Protein, Mouse (HEK293, His)

The PLXDC2 protein is associated with tumor angiogenesis, suggesting its potential role in blood vessel growth in the tumor microenvironment. The specific mechanism and downstream signaling pathways by which PLXDC2 promotes tumor angiogenesis need to be further elucidated, thus prompting people to explore its role in promoting vascularization during tumorigenesis. PLXDC2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLXDC2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of PLXDC2 Protein, Mouse (HEK293, His) is 425 a.a., with molecular weight of ~70-90 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PLXDC2 protein is associated with tumor angiogenesis, suggesting its potential role in blood vessel growth in the tumor microenvironment. The specific mechanism and downstream signaling pathways by which PLXDC2 promotes tumor angiogenesis need to be further elucidated, thus prompting people to explore its role in promoting vascularization during tumorigenesis. PLXDC2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLXDC2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of PLXDC2 Protein, Mouse (HEK293, His) is 425 a.a., with molecular weight of ~70-90 kDa.

Background

PLXDC2 Protein is implicated in tumor angiogenesis, suggesting its potential involvement in the complex processes associated with the growth of blood vessels within the tumor microenvironment. The specific mechanisms through which PLXDC2 contributes to tumor angiogenesis and its downstream signaling pathways remain to be fully elucidated, warranting further investigation into its role in promoting vascularization during tumorigenesis. Notably, PLXDC2 interacts with CTTN, indicating a potential molecular association that may contribute to its functions in tumor-related angiogenic processes. The intricacies of PLXDC2's role in tumor angiogenesis and its interactions with other cellular components underscore the need for in-depth exploration to better understand its contribution to cancer progression.

Biological Activity

Immobilized Mouse PLXDC2 at 2 μg/mL or 5 μg/mL (100 μL/well) can bind Anti-PLXDC2 Antibody, The ED50 for this effect is 0.4-1.749 μg/mL.

  • Immobilized Mouse PLXDC2 at 2 μg/mL (100 μL/well) can bind Anti-PLXDC2 Antibody, The ED50 for this effect is 1.749 μg/mL.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q9DC11 (E31-A455)

Gene ID
Molecular Construction
N-term
PLXDC2 (E31-A455)
Accession # Q9DC11
6*His
C-term
Synonyms
Plexin domain-containing protein 2; Tumor endothelial marker 7-related protein; Plxdc2; Tem7r
AA Sequence

EPGHHTNDWIYEVTNAFPWNEEGVEVDSQAYNHRWKRNVDPFKAVDTNRASMGQASPESKGFTDLLLDDGQDNNTQIEEDTDHNYYISRIYGPADSASRDLWVNIDQMEKDKVKIHGILSNTHRQAARVNLSFDFPFYGHFLNEVTVATGGFIYTGEVVHRMLTATQYIAPLMANFDPSVSRNSTVRYFDNGTALVVQWDHVHLQDNYNLGSFTFQATLLMDGRIIFGYKEIPVLVTQISSTNHPVKVGLSDAFVVVHRIQQIPNVRRRTIYEYHRVELQMSKITNISAVEMTPLPTCLQFNGCGPCVSSQIGFNCSWCSKLQRCSSGFDRHRQDWVDSGCPEEVQSKEKMCEKTEPGETSQTTTTSHTTTMQFRVLTTTRRAVTSQMPTSLPTEDDTKIALHLKDSGASTDDSAAEKKGGTLHA

Molecular Weight

Approximately 70-96 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Glycine-HCl, 10% Trehalose, 0.05% Tween 80, pH 3.5 or PBS, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PLXDC2 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PLXDC2 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P71215
Quantity:
MCE Japan Authorized Agent: