PMM1 Protein, Human (His)

The PMM1 protein is key to the synthesis of GDP-mannose and polyethylene glycol-phosphate-mannose and is essential for the mannosyl transfer reaction. Its enzymatic activity contributes to the biosynthesis of mannose-containing glycoconjugates, which are critical for protein glycosylation and related cellular processes. PMM1 Protein, Human (His) is the recombinant human-derived PMM1 protein, expressed by E. coli , with C-6*His labeled tag. The total length of PMM1 Protein, Human (His) is 262 a.a., with molecular weight of ~49.0 kDa.

The PMM1 Protein plays a pivotal role in the synthesis of GDP-mannose and dolichol-phosphate-mannose, crucial for various essential mannosyl transfer reactions. Its enzymatic activities contribute to the biosynthesis of mannose-containing glycoconjugates, playing a vital role in protein glycosylation and related cellular processes. Moreover, PMM1 may have an additional role in the degradation of glucose-1,6-bisphosphate in the ischemic brain, suggesting its involvement in metabolic responses to ischemic conditions. The multifaceted functions of PMM1 underscore its significance in cellular homeostasis and underline its potential contribution to glycosylation processes and metabolic adaptations in specific physiological contexts.

Human

E. coli

C-6*His

Q92871 (M1-A262)

5372  [NCBI]

MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEA

Approximately 49.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.