PMM2 Protein, Human (His)

The PMM2 protein is essential for the synthesis of GDP-mannose and polyethylene glycol-phosphate-mannose, which are essential for the mannosyl transfer reaction. Its enzymatic activity is integral to the biosynthesis of mannose-containing glycoconjugates, affects protein glycosylation and contributes to cellular homeostasis. PMM2 Protein, Human (His) is the recombinant human-derived PMM2 protein, expressed by E. coli , with C-6*His labeled tag.

The PMM2 Protein plays a vital role in the synthesis of GDP-mannose and dolichol-phosphate-mannose, essential for numerous critical mannosyl transfer reactions. Its enzymatic activity is integral to the biosynthesis of mannose-containing glycoconjugates, contributing to various cellular processes such as protein glycosylation. PMM2's involvement in these pathways underscores its significance in cellular homeostasis and the proper functioning of glycosylation processes essential for the synthesis of various glycoconjugates with crucial biological functions.

Human

E. coli

C-6*His

O15305-1 (M1-S246)

5373  [NCBI]

MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS

Approximately 29.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.