1. Recombinant Proteins
  2. Others
  3. PMM2 Protein, Human (His)

The PMM2 protein is essential for the synthesis of GDP-mannose and polyethylene glycol-phosphate-mannose, which are essential for the mannosyl transfer reaction. Its enzymatic activity is integral to the biosynthesis of mannose-containing glycoconjugates, affects protein glycosylation and contributes to cellular homeostasis. PMM2 Protein, Human (His) is the recombinant human-derived PMM2 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PMM2 protein is essential for the synthesis of GDP-mannose and polyethylene glycol-phosphate-mannose, which are essential for the mannosyl transfer reaction. Its enzymatic activity is integral to the biosynthesis of mannose-containing glycoconjugates, affects protein glycosylation and contributes to cellular homeostasis. PMM2 Protein, Human (His) is the recombinant human-derived PMM2 protein, expressed by E. coli , with C-6*His labeled tag.

Background

The PMM2 Protein plays a vital role in the synthesis of GDP-mannose and dolichol-phosphate-mannose, essential for numerous critical mannosyl transfer reactions. Its enzymatic activity is integral to the biosynthesis of mannose-containing glycoconjugates, contributing to various cellular processes such as protein glycosylation. PMM2's involvement in these pathways underscores its significance in cellular homeostasis and the proper functioning of glycosylation processes essential for the synthesis of various glycoconjugates with crucial biological functions.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

O15305-1 (M1-S246)

Gene ID
Molecular Construction
N-term
PMM2 (M1-S246)
Accession # O15305-1
6*His
C-term
Synonyms
Phosphomannomutase 2; PMM 2; PMM2
AA Sequence

MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS

Molecular Weight

Approximately 29.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PMM2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PMM2 Protein, Human (His)
Cat. No.:
HY-P71021
Quantity:
MCE Japan Authorized Agent: