1. Recombinant Proteins
  2. Others
  3. Podoplanin Protein, Human (HEK293, His)

Podoplanin Protein, Human (HEK293, His)

Cat. No.: HY-P71218
SDS COA Handling Instructions

The Podoplanin protein is a multifaceted regulator that affects cell migration and adhesion through multiple interactions. In hemo-lymphatic dissociation, Podoplanin binds to CLEC1B, triggering platelet activation that is counteracted by the CD9 interaction. Podoplanin Protein, Human (HEK293, His) is the recombinant human-derived Podoplanin protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Podoplanin protein is a multifaceted regulator that affects cell migration and adhesion through multiple interactions. In hemo-lymphatic dissociation, Podoplanin binds to CLEC1B, triggering platelet activation that is counteracted by the CD9 interaction. Podoplanin Protein, Human (HEK293, His) is the recombinant human-derived Podoplanin protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Podoplanin Protein emerges as a multifaceted regulator, exerting diverse effects on cell migration and adhesion through interactions with various partners. During development, Podoplanin plays a crucial role in the separation of blood and lymphatic vessels by binding to CLEC1B, triggering platelet activation and aggregation. Conversely, its interaction with CD9 attenuates platelet aggregation induced by Podoplanin. The protein, through interactions with MSN or EZR, promotes epithelial-mesenchymal transition (EMT), leading to increased cell migration and invasiveness. Binding with CD44 facilitates directional cell migration in epithelial and tumor cells. In lymph nodes, Podoplanin controls fibroblastic reticular cells (FRCs) adhesion to the extracellular matrix (ECM) and actomyosin contraction by maintaining ERM proteins (EZR, MSN, and RDX) and MYL9 activation. Engagement with CLEC1B promotes FRC relaxation by blocking lateral membrane interactions. Podoplanin also participates in connecting the lymphatic endothelium to the surrounding ECM through its interaction with LGALS8. In keratinocytes, Podoplanin induces morphological changes, increased motility, and decreased cell adhesion. Furthermore, Podoplanin regulates invadopodia stability and maturation in tumor cells, contributing to efficient ECM degradation. The protein is homodimeric and interacts with a range of partners, including CLEC1B, CD9, LGALS8, CD44, MSN, EZR, and CCL21, showcasing its intricate involvement in various cellular processes and signaling pathways. Further research is crucial to unravel the precise molecular mechanisms and broader implications of Podoplanin in these diverse cellular functions.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q86YL7-1 (A23-L131)

Gene ID
Molecular Construction
N-term
Podoplanin (A23-L131)
Accession # Q86YL7-1
6*His
C-term
Synonyms
Podoplanin; Aggrus; Glycoprotein 36; Gp36; PA2.26 Antigen; T1-Alpha; T1A; PDPN; GP36
AA Sequence

ASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTL

Molecular Weight

20-30 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Podoplanin Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Podoplanin Protein, Human (HEK293, His)
Cat. No.:
HY-P71218
Quantity:
MCE Japan Authorized Agent: