2. Recombinant Proteins
  3. Others
  4. Pollen allergen Phl p 5b Protein, Phleum pratense (His-SUMO)

Pollen allergen Phl p 5b Protein, Phleum pratense (His-SUMO)

Cat. No.: HY-P71554
Handling Instructions

Pollen allergen Phl p 5b protein, with ribonuclease activity, is speculated to participate in host-pathogen interactions. Its structural configuration involves a homodimer linked by disulfide bonds, highlighting its molecular arrangement in cellular processes. Pollen allergen Phl p 5b Protein, Phleum pratense (His-SUMO) is the recombinant Pollen allergen Phl p 5b protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Pollen allergen Phl p 5b protein, with ribonuclease activity, is speculated to participate in host-pathogen interactions. Its structural configuration involves a homodimer linked by disulfide bonds, highlighting its molecular arrangement in cellular processes. Pollen allergen Phl p 5b Protein, Phleum pratense (His-SUMO) is the recombinant Pollen allergen Phl p 5b protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
Background

The Pollen allergen Phl p 5b protein exhibits ribonuclease activity and is speculated to play a role in host-pathogen interactions. Structurally, it forms a homodimer that is linked by disulfide bonds, emphasizing its molecular arrangement in cellular processes.
Species

Others
Source

E. coli
Tag

N-His;N-SUMO
Accession

Q40963 (A20-V284)
Gene ID

/
Molecular Construction
N-term
6*His-SUMO
Phl p 5b (A20-V284)
Accession # Q40963
C-term
Synonyms
Pollen allergen Phl p 5b; Allergen Phl p Vb; allergen Phl p 5b; Fragment
AA Sequence

ADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV

Molecular Weight

Approximately 42.1 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

Pollen allergen Phl p 5b Protein, Phleum pratense (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Pollen allergen Phl p 5b Protein, Phleum pratense (His-SUMO)
Cat. No.:
HY-P71554
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.