1. Recombinant Proteins
  2. Receptor Proteins
  3. Nuclear Receptor Superfamily
  4. Peroxisome Proliferator-activated Receptor
  5. PPAR alpha
  6. PPAR alpha Protein, Human (His)

PPAR alpha Protein, human (His), a member of the nuclear receptor family, is a transcription factor that regulates the expression of genes related to lipid metabolism in a ligand-dependent manner.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE PPAR alpha Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

PPAR alpha Protein, human (His), a member of the nuclear receptor family, is a transcription factor that regulates the expression of genes related to lipid metabolism in a ligand-dependent manner.

Background

Peroxisome proliferator-activated receptors (PPARs) are ligand-dependent transcription factors that belong to the nuclear receptor superfamily comprising 48 members in human. PPARs include three subtypes, PPARα, PPARγ, and PPARδ. PPARα is involved in lipid homeostasis by regulating the transcription of sets of genes related to lipid metabolism and thereby reducing blood triglyceride levels. PPARα has attracted attention as a target for hypolipidemic drugs[1].

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q07869-1 (D202-Y468)

Gene ID
Molecular Construction
N-term
6*His
PPAR alpha (D202-Y468)
Accession # Q07869-1
C-term
Synonyms
PPARA, PPAR-α
AA Sequence

DLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY

Molecular Weight

Approximately 32.5kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.2 μm filtered solution of PBS, pH 8.0 or PBS, 2 M Urea.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PPAR alpha Protein, Human (His)
Cat. No.:
HY-P7996
Quantity:
MCE Japan Authorized Agent: