1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. PPIase A Protein, E.coli (His-SUMO)

The PPIase A protein plays a central role in complex protein folding, utilizing its peptidyl-prolyl cis-trans isomerase (PPIase) activity to accelerate dynamic conformational changes that are critical for proper protein maturation. PPIase A specifically catalyzes the cis-trans isomerization of proline imide peptide bonds, effectively promoting protein folding. PPIase A Protein, E.coli (His-SUMO) is the recombinant E. coli-derived PPIase A protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PPIase A protein plays a central role in complex protein folding, utilizing its peptidyl-prolyl cis-trans isomerase (PPIase) activity to accelerate dynamic conformational changes that are critical for proper protein maturation. PPIase A specifically catalyzes the cis-trans isomerization of proline imide peptide bonds, effectively promoting protein folding. PPIase A Protein, E.coli (His-SUMO) is the recombinant E. coli-derived PPIase A protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

PPIase A Protein emerges as a key player in the intricate process of protein folding, leveraging its peptidyl-prolyl cis-trans isomerase (PPIase) activity to accelerate the dynamic conformational changes crucial for proper protein maturation. With a specific role in catalyzing the cis-trans isomerization of proline imidic peptide bonds in oligopeptides, PPIase A facilitates the efficient folding of proteins. This enzymatic capability underscores its significance in maintaining the structural integrity of nascent or misfolded polypeptides, contributing to the overall cellular protein homeostasis. The multifunctional role of PPIase A in orchestrating protein folding processes positions it as a key molecular player in cellular physiology, prompting further exploration to elucidate the specific molecular mechanisms and cellular contexts through which PPIase A actively contributes to the intricate choreography of protein folding.

Species

E.coli

Source

E. coli

Tag

N-His;N-SUMO

Accession

P0AFL5 (A25-P190)

Gene ID

66672756  [NCBI]

Molecular Construction
N-term
6*His-SUMO
PPIase A (A25-P190)
Accession # P0AFL5
C-term
Synonyms
ppiA; Z4724; ECs4214; Peptidyl-prolyl cis-trans isomerase A; PPIase A; EC 5.2.1.8; Cyclophilin A; Rotamase A
AA Sequence

AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP

Molecular Weight

Approximately 34.1 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PPIase A Protein, E.coli (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PPIase A Protein, E.coli (His-SUMO)
Cat. No.:
HY-P71501
Quantity:
MCE Japan Authorized Agent: