1. Recombinant Proteins
  2. Others
  3. PRAT4B/CNPY4 Protein, Mouse (HEK293, His)

PRAT4B/CNPY4 Protein is pivotal in regulating TLR4 cell surface expression, actively orchestrating cellular processes. Direct interaction with TLR4 underscores its crucial involvement, emphasizing significance in steering molecular pathways. This dynamic interplay highlights PRAT4B/CNPY4's essential contribution to finely tuning cellular responses, establishing it as a key regulatory factor in immune-related signaling cascades. PRAT4B/CNPY4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PRAT4B/CNPY4 protein, expressed by HEK293 , with C-His labeled tag. The total length of PRAT4B/CNPY4 Protein, Mouse (HEK293, His) is 218 a.a., with molecular weight of ~26.5 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PRAT4B/CNPY4 Protein is pivotal in regulating TLR4 cell surface expression, actively orchestrating cellular processes. Direct interaction with TLR4 underscores its crucial involvement, emphasizing significance in steering molecular pathways. This dynamic interplay highlights PRAT4B/CNPY4's essential contribution to finely tuning cellular responses, establishing it as a key regulatory factor in immune-related signaling cascades. PRAT4B/CNPY4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PRAT4B/CNPY4 protein, expressed by HEK293 , with C-His labeled tag. The total length of PRAT4B/CNPY4 Protein, Mouse (HEK293, His) is 218 a.a., with molecular weight of ~26.5 KDa.

Background

The PRAT4B/CNPY4 protein plays a pivotal role in regulating the cell surface expression of TLR4, actively engaging in the orchestration of cellular processes. Its direct interaction with TLR4 underscores its crucial involvement, emphasizing its significance in steering molecular pathways. This dynamic interplay between PRAT4B/CNPY4 and TLR4 highlights the protein's essential contribution to finely tuning cellular responses, establishing it as a key regulatory factor in immune-related signaling cascades.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q8BQ47 (E28-L245)

Gene ID
Molecular Construction
N-term
PRAT4B (E28-L245)
Accession # Q8BQ47
His
C-term
Synonyms
Protein canopy homolog 4; Protein associated with Tlr4; Prat4b
AA Sequence

EATKEEEDDTERLPSKCEVCKLLSMELQEALSRTGRSREVLELGQVLDTGKRKRHVPYSLSETRLEEALENLCERILDYNVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTFLKKQCETMLEEFEDVVGDWYFHHQEQPLQHFLCERHVLPASETACLREAWTGKEKISDGQEEADDEEEEEEEEITKTSGNPKHDPEDL

Molecular Weight

Approximately 27 kDa.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PRAT4B/CNPY4 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PRAT4B/CNPY4 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P76840
Quantity:
MCE Japan Authorized Agent: