PRDX5/Peroxiredoxin-5 Protein, Mouse (His)

The PRDX5/Peroxiredoxin-5 protein is a thiol-specific peroxidase that reduces hydrogen peroxide and organic hydroperoxides to water and alcohols. It plays a vital role in cellular protection from oxidative stress and detoxifying peroxides to maintain redox balance. PRDX5/Peroxiredoxin-5 Protein, Mouse (His) is the recombinant mouse-derived PRDX5/Peroxiredoxin-5 protein, expressed by E. coli , with N-His labeled tag.

PRDX5/Peroxiredoxin-5 Protein operates as a thiol-specific peroxidase, catalyzing the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. This protein plays a crucial role in cellular protection against oxidative stress by detoxifying various peroxides, showcasing its significance in maintaining cellular redox balance. Additionally, PRDX5 acts as a sensor of hydrogen peroxide-mediated signaling events, suggesting its involvement in modulating cellular responses to oxidative stress. The dual functionality of PRDX5 underscores its importance in cellular defense mechanisms and its potential contribution to regulatory pathways associated with redox signaling.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Mouse

E. coli

N-His

P99029-1 (M49-L210)

54683  [NCBI]

MAPIKVGDAIPSVEVFEGEPGKKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAGALKAKGAQVVACLSVNDVFVIEEWGRAHQAEGKVRLLADPTGAFGKATDLLLDDSLVSLFGNRRLKRFSMVIDNGIVKALNVEPDGTGLTCSLAPNILSQL

Approximately 18.5 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.