1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. PRDX5/Peroxiredoxin-5 Protein, Mouse (His)

The PRDX5/Peroxiredoxin-5 protein is a thiol-specific peroxidase that reduces hydrogen peroxide and organic hydroperoxides to water and alcohols. It plays a vital role in cellular protection from oxidative stress and detoxifying peroxides to maintain redox balance. PRDX5/Peroxiredoxin-5 Protein, Mouse (His) is the recombinant mouse-derived PRDX5/Peroxiredoxin-5 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

PRDX5/Peroxiredoxin-5 Protein, Mouse (His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PRDX5/Peroxiredoxin-5 protein is a thiol-specific peroxidase that reduces hydrogen peroxide and organic hydroperoxides to water and alcohols. It plays a vital role in cellular protection from oxidative stress and detoxifying peroxides to maintain redox balance. PRDX5/Peroxiredoxin-5 Protein, Mouse (His) is the recombinant mouse-derived PRDX5/Peroxiredoxin-5 protein, expressed by E. coli , with N-His labeled tag.

Background

PRDX5/Peroxiredoxin-5 Protein operates as a thiol-specific peroxidase, catalyzing the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. This protein plays a crucial role in cellular protection against oxidative stress by detoxifying various peroxides, showcasing its significance in maintaining cellular redox balance. Additionally, PRDX5 acts as a sensor of hydrogen peroxide-mediated signaling events, suggesting its involvement in modulating cellular responses to oxidative stress. The dual functionality of PRDX5 underscores its importance in cellular defense mechanisms and its potential contribution to regulatory pathways associated with redox signaling.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Mouse

Source

E. coli

Tag

N-His

Accession

P99029-1 (M49-L210)

Gene ID
Molecular Construction
N-term
His
PRDX5 (M49-L210)
Accession # P99029-1
C-term
Synonyms
Peroxiredoxin-5; PLP; Prx-V; Prdx5; AOEB166
AA Sequence

MAPIKVGDAIPSVEVFEGEPGKKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAGALKAKGAQVVACLSVNDVFVIEEWGRAHQAEGKVRLLADPTGAFGKATDLLLDDSLVSLFGNRRLKRFSMVIDNGIVKALNVEPDGTGLTCSLAPNILSQL

Molecular Weight

Approximately 19 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 6.5, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PRDX5/Peroxiredoxin-5 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PRDX5/Peroxiredoxin-5 Protein, Mouse (His)
Cat. No.:
HY-P73375
Quantity:
MCE Japan Authorized Agent: