1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. PRL8A4 Protein, Rat (HEK293, His)

PRL8A4 Protein, Rat (HEK293, His)

Cat. No.: HY-P77466
SDS COA Handling Instructions

The PRL8A4 protein is involved in regulating cells in the basal zone of the placenta, suggesting a potential impact on placental development. Although important, the specific functions and molecular mechanisms of PRL8A4 in these cells require further exploration. PRL8A4 Protein, Rat (HEK293, His) is the recombinant rat-derived PRL8A4 protein, expressed by HEK293 , with C-His labeled tag. The total length of PRL8A4 Protein, Rat (HEK293, His) is 208 a.a., with molecular weight of ~24 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PRL8A4 protein is involved in regulating cells in the basal zone of the placenta, suggesting a potential impact on placental development. Although important, the specific functions and molecular mechanisms of PRL8A4 in these cells require further exploration. PRL8A4 Protein, Rat (HEK293, His) is the recombinant rat-derived PRL8A4 protein, expressed by HEK293 , with C-His labeled tag. The total length of PRL8A4 Protein, Rat (HEK293, His) is 208 a.a., with molecular weight of ~24 KDa.

Background

The PRL8A4 Protein is implicated in the regulation of placental basal zone cells. Its role within this context suggests a potential influence on processes integral to placental development and function. The specific functions and molecular mechanisms associated with PRL8A4 in placental basal zone cells remain an area of interest and warrant further exploration to unravel its contribution to the intricate processes occurring in this critical region of the placenta. Understanding the involvement of PRL8A4 Protein in placental basal zone cells may offer insights into the molecular underpinnings of placental physiology and its implications for overall reproductive health.

Species

Rat

Source

HEK293

Tag

C-6*His

Accession

P33580 (I32-C239)

Gene ID

59088  [NCBI]

Molecular Construction
N-term
PRL8A4 (I32-C239)
Accession # P33580
His
C-term
Synonyms
Prolactin-8A4; Growth hormone-related placental protein 3; PLP-H; Prlph
AA Sequence

IPACMVEEGDCWDPLQETFNSAIQRAETLCNLADQLYVEFYQNQFSSRQFADLNSKLIKRDETVLKAGIYCHSTLAKPQTRGGNFEIEEHLKMLINFVGSWISPLFHLVIELSAMEGVPETILCKVKDLEENNRQLLDDLRWILTKVSPTAEIREEFPSWEHLSFLKSSNKNNKFLAMFNLSNCLDNDTKFTLHHLRIFKCLITGKDC

Molecular Weight

Approximately 24 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PRL8A4 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PRL8A4 Protein, Rat (HEK293, His)
Cat. No.:
HY-P77466
Quantity:
MCE Japan Authorized Agent: