2. Recombinant Proteins
  3. Others
  4. PRND Protein, Human (HEK293, His)

PRND Protein, Human (HEK293, His)

Cat. No.: HY-P71236
Handling Instructions

PRND protein is crucial for orchestrating the normal acrosome reaction, ensuring male fertility, and exhibiting copper ion binding capabilities.Its dual functionality highlights its significance in the intricate molecular mechanisms governing male reproductive functions and copper ion interactions.PRND Protein, Human (HEK293, His) is the recombinant human-derived PRND protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PRND protein is crucial for orchestrating the normal acrosome reaction, ensuring male fertility, and exhibiting copper ion binding capabilities.Its dual functionality highlights its significance in the intricate molecular mechanisms governing male reproductive functions and copper ion interactions.PRND Protein, Human (HEK293, His) is the recombinant human-derived PRND protein, expressed by HEK293 , with C-6*His labeled tag.
Background

PRND protein is essential for orchestrating the normal acrosome reaction and ensuring regular male fertility. Beyond its critical role in these reproductive processes, PRND exhibits the capability to bind copper ions, as indicated by studies. This dual functionality underscores its significance in the intricate molecular mechanisms governing male reproductive functions and copper ion interactions.
Species

Human
Source

HEK293
Tag

C-6*His
Accession

Q9UKY0 (R27-G152)
Gene ID
Molecular Construction
N-term
PRND (R27-G152)
Accession # Q9UKY0
6*His
C-term
Synonyms
Prion-like protein doppel; PrPLP; Prion protein 2; PRND; DPL
AA Sequence

RGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERG

Molecular Weight

20-29 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

PRND Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PRND Protein, Human (HEK293, His)
Cat. No.:
HY-P71236
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.