1. Recombinant Proteins
  2. CD Antigens
  3. Erythrocyte CD Proteins
  4. PRNP/CD230 Protein, Human (HEK293, hFc)

Although its primary function is unknown, the PRNP/CD230 protein has been implicated in multiple neuronal processes, including neuronal development, synaptic plasticity, and myelin homeostasis. PRNP acts as an agonist of the ADGRG6 receptor and promotes the maintenance of myelin. PRNP/CD230 Protein, Human (HEK293, Fc) is the recombinant human-derived PRNP/CD230 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Although its primary function is unknown, the PRNP/CD230 protein has been implicated in multiple neuronal processes, including neuronal development, synaptic plasticity, and myelin homeostasis. PRNP acts as an agonist of the ADGRG6 receptor and promotes the maintenance of myelin. PRNP/CD230 Protein, Human (HEK293, Fc) is the recombinant human-derived PRNP/CD230 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

PRNP/CD230, while its primary physiological function remains unclear, is implicated in various neuronal processes, including neuronal development and synaptic plasticity. Additionally, it may play a crucial role in maintaining the myelin sheath of neurons and promoting myelin homeostasis by acting as an agonist for the ADGRG6 receptor. The protein's involvement in iron uptake and homeostasis further underscores its multifaceted functions. Soluble oligomers of PRNP exhibit toxicity to neuroblastoma cells, inducing apoptosis in vitro. Association with GPC1, facilitated by heparan sulfate chains, targets PRNP to lipid rafts and contributes to Cu(2+) or Zn(2+) availability for the ascorbate-mediated GPC1 deaminase degradation of its heparan sulfate side chains. PRNP exists both as a monomer and homodimer, with a propensity to aggregate into amyloid fibrils, possibly influenced by copper binding. Notably, PRNP interacts with various proteins, including GRB2, APP, ERI3/PRNPIP, SYN1, and ADGRG6, suggesting a complex network of molecular interactions.

Biological Activity

Measured by its ability to inhibit proliferation of SH-SY5Y cells. The ED50 for this effect is 0.135 μg/mL, corresponding to a specific activity is 7.358×103 units/mg.

  • Measured by its ability to inhibit proliferation of SH-SY5Y cells. The ED50 for this effect is 0.135 μg/mL,corresponding to a specific activity is 7.358×103 units/mg.
Species

Human

Source

HEK293

Tag

C-hFc

Accession

P04156 (K23-G229)

Gene ID

5621

Molecular Construction
N-term
PRNP (K23-G229)
Accession # P04156/NP_000302.1
hFc
C-term
Synonyms
Major prion protein; CD230; ALTPRP; PRIP; PRP
AA Sequence

KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRG

Molecular Weight

Approximately 58-70 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PRNP/CD230 Protein, Human (HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PRNP/CD230 Protein, Human (HEK293, hFc)
Cat. No.:
HY-P74619A
Quantity:
MCE Japan Authorized Agent: