Betacellulin Protein, Human

Probetacellulin Protein, Human is a glycoprotein, improves glucose tolerance by promoting β-cell differentiation and regeneration from ductal and/or acinar cells.

Betacellulin (BTC), a member of the epidermal growth factor family, is expressed predominantly in the human pancreas and induces the differentiation of a pancreatic acinar cell line (AR42J) into insulin-secreting cells. Betacellulin binds and activates the EGF receptor (EGFR/erbB-1) and erbB-4, and it induces tyrosine phosphorylation of erbB-2, which couples with the EGFR or erbB-4^[1].

The ED₅₀ is <0.01 ng/mL as measured by murine Balb/3T3 cells, corresponding to a specific activity of >1.0 × 10⁸ units/mg.

Human

E. coli

Tag Free

P35070 (D32-Y111)

685  [NCBI]

DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY

Approximately 15 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS.

< 0.2 EU/μg of protein by gel clotting method

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Yamamoto K, et al. Recombinant human betacellulin promotes the neogenesis of beta-cells and ameliorates glucose intolerance in mice with diabetes induced by selective alloxan perfusion. Diabetes. 2000 Dec;49(12):2021-7.  [Content Brief]