Progranulin/PGRN Protein, Human (HEK293, C-His)

EpCAM/TROP1 protein is a cell surface protein expressed in a variety of epithelial tissues. It plays a crucial role in cell adhesion, proliferation and differentiation. Progranulin/PGRN Protein, Human (HEK293, C-His) is the recombinant human-derived Progranulin/PGRN protein, expressed by HEK293 , with C-10*His labeled tag. The total length of Progranulin/PGRN Protein, Human (HEK293, C-His) is 576 a.a., with molecular weight of 80-95 kDa.

The Progranulin/PGRN Protein represents an 88 kDa precursor protein, also known as proepithelin and PC cell-derived growth factor, from which a family of secreted, glycosylated peptides called granulins is cleaved. This cleavage yields mature granulins, further processed into active 6 kDa peptides, including granulin A, granulin B, granulin C, and so forth. Epithelins 1 and 2 are synonymous with granulins A and B, respectively. The granulin family, with its 7.5 repeats of a highly conserved 12-cysteine granulin/epithelin motif, plays a crucial role in regulating cell growth, with various members acting as inhibitors, stimulators, or having dual actions on cell growth. Ubiquitously expressed, Progranulin/PGRN exhibits elevated levels in the bone marrow (RPKM 141.7), lung (RPKM 139.8), and 25 other tissues, emphasizing its potential significance in diverse physiological processes across multiple organs.

1.Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED₅₀ for this effect is 0.6157 μg/mL, corresponding to a specific activity is 1.62×10³ U/mg.
2.Measured by its ability to inhibit THP-1 human acute monocyte migration in the presence of 10 ng/mL MCP-1.

• 
  Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED₅₀ for this effect is 0.6157 μg/mL, corresponding to a specific activity is 1.62×10³ U/mg.

Human

HEK293

C-10*His

NP_002078.1/P28799 (T18-L593)

2896  [NCBI]

TRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL

Approximately 80-95 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 5 % trehalose, 5 % mannitol and 0.01% Tween80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.