1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Insulin
  5. Proinsulin Protein, Human (His)

Proinsulin is the precursor of insulin, a key hormone that regulates carbohydrate and lipid metabolism. Post-translational cleavage produces insulin, which consists of B and A chain peptides and a C peptide linked by disulfide bonds. Proinsulin Protein, Human (His) is the recombinant human-derived Proinsulin protein, expressed by E. coli , with N-6*His labeled tag. The total length of Proinsulin Protein, Human (His) is 86 a.a..

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Proinsulin is the precursor of insulin, a key hormone that regulates carbohydrate and lipid metabolism. Post-translational cleavage produces insulin, which consists of B and A chain peptides and a C peptide linked by disulfide bonds. Proinsulin Protein, Human (His) is the recombinant human-derived Proinsulin protein, expressed by E. coli , with N-6*His labeled tag. The total length of Proinsulin Protein, Human (His) is 86 a.a..

Background

Proinsulin Protein, encoded by this gene, is the precursor of insulin, a crucial peptide hormone that plays a pivotal role in regulating carbohydrate and lipid metabolism. Following the removal of the precursor signal peptide, proinsulin undergoes post-translational cleavage, generating three peptides: the B chain and A chain peptides, which covalently link to form insulin, and C-peptide. The binding of insulin to the insulin receptor (INSR) stimulates glucose uptake, a process integral to metabolic homeostasis. Various mutant alleles with diverse phenotypic effects, such as insulin-dependent diabetes mellitus, permanent neonatal diabetes mellitus, maturity-onset diabetes of the young type 10, and hyperproinsulinemia, have been identified. Notably, expression of this gene is predominantly restricted to the pancreas, emphasizing its central role in glucose regulation and metabolism within pancreatic tissues. Additionally, a read-through gene, INS-IGF2, overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region, further contributing to the complexity of regulatory mechanisms in this genomic locus.

Biological Activity

Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect is 0.5182μg/mL.

  • Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect is 0.5182 μg/mL. corresponding to a specific activity is 1929.7 units/mg.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

NP_000198.1 (F25-N110)

Gene ID

3630

Molecular Construction
N-term
6*His
Proinsulin (F25-N110)
Accession # NP_000198
C-term
Synonyms
IDDM2; ILPR; insulin; IRDN; MODY10; Proinsulin
AA Sequence

FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN

Molecular Weight

Approximately 10 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Proinsulin Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Proinsulin Protein, Human (His)
Cat. No.:
HY-P702540
Quantity:
MCE Japan Authorized Agent: