1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Prolactin
  5. Prolactin Protein, Pig (His-SUMO)

Prolactin Protein, Pig (His-SUMO)

Cat. No.: HY-P72287
SDS COA Handling Instructions

Prolactin Protein plays a key role in the mammary gland by primarily promoting lactation through its interaction with the PRLR receptor, facilitating the lactation process. Prolactin Protein, Pig (His-SUMO) is the recombinant pig-derived Prolactin protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of Prolactin Protein, Pig (His-SUMO) is 199 a.a., with molecular weight of ~39.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $58 In-stock
10 μg $145 In-stock
50 μg $305 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Prolactin Protein plays a key role in the mammary gland by primarily promoting lactation through its interaction with the PRLR receptor, facilitating the lactation process. Prolactin Protein, Pig (His-SUMO) is the recombinant pig-derived Prolactin protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of Prolactin Protein, Pig (His-SUMO) is 199 a.a., with molecular weight of ~39.0 kDa.

Background

Prolactin protein plays a key role in the mammary gland by primarily promoting lactation. This is accomplished through its interaction with the PRLR receptor, which facilitates the process of lactation.

Species

Pig

Source

E. coli

Tag

N-His;N-SUMO

Accession

P01238 (L31-C229)

Gene ID
Molecular Construction
N-term
6*His-SUMO
Prolactin (L31-C229)
Accession # P01238
C-term
Synonyms
PRL; Prolactin; PRL
AA Sequence

LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC

Molecular Weight

Approximately 39.0kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution in PBS, pH 7.4.

Endotoxin Level

<1.0 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Prolactin Protein, Pig (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Prolactin Protein, Pig (His-SUMO)
Cat. No.:
HY-P72287
Quantity:
MCE Japan Authorized Agent: