1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Prolactin
  5. Prolactin Protein, Rat (His)

Prolactin Protein primarily promotes lactation by exerting its main actions on the mammary gland.This crucial function is facilitated through interaction with its specific receptor, PRLR.Prolactin Protein, Rat (His) is the recombinant rat-derived Prolactin protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Prolactin Protein primarily promotes lactation by exerting its main actions on the mammary gland.This crucial function is facilitated through interaction with its specific receptor, PRLR.Prolactin Protein, Rat (His) is the recombinant rat-derived Prolactin protein, expressed by E.coli , with N-6*His labeled tag.

Background

Prolactin protein exerts its main actions on the mammary gland, primarily promoting lactation. This crucial function is achieved through its interaction with the specific receptor known as PRLR, which facilitates the process of lactation.

Biological Activity

Measured in a cell proliferation assay using Nb2-11 rat lymphoma cells. The ED50 for this effect is 0.288-0.5528 ng/mL.

  • Measured in a cell proliferation assay using Nb211 rat lymphoma cells. The ED50 for this effect is 0.288 ng/mL, corresponding to a specific activity is 3.472×106 units/mg.
Species

Rat

Source

E. coli

Tag

N-6*His

Accession

P01237 (L30-C226)

Gene ID
Molecular Construction
N-term
6*His
Prolactin (L30-C226)
Accession # P01237
C-term
Synonyms
Prl; Prolactin; PRL
AA Sequence

LPVCSGGDCQTPLPELFDRVVMLSHYIHTLYTDMFIEFDKQYVQDREFIAKAINDCPTSSLATPEDKEQAQKVPPEVLLNLILSLVHSWNDPLFQLITGLGGIHEAPDAIISRAKEIEEQNKRLLEGIEKIISQAYPEAKGNEIYLVWSQLPSLQGVDEESKDLAFYNNIRCLRRDSHKVDNYLKFLRCQIVHKNNC

Molecular Weight

Approximately 24 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Prolactin Protein, Rat (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Prolactin Protein, Rat (His)
Cat. No.:
HY-P71916A
Quantity:
MCE Japan Authorized Agent: