Prolactin R Protein, Rat (HEK293, His)

Prolactin R protein is a receptor for prolactin and can initiate signaling cascades to regulate physiological processes.Interacting with SMARCA1, it may be involved in chromatin remodeling.Prolactin R Protein, Rat (HEK293, His) is the recombinant rat-derived Prolactin R protein, expressed by HEK293 , with C-His labeled tag.

Prolactin R Protein serves as a receptor specifically designed for the anterior pituitary hormone prolactin. Through its binding with prolactin, this receptor initiates signaling cascades that modulate various physiological processes. Notably, Prolactin R Protein interacts with SMARCA1, indicating potential involvement in chromatin remodeling processes. Furthermore, its interactions with NEK3 and VAV2 are prolactin-dependent, suggesting a dynamic and regulated interplay in response to prolactin stimulation. These molecular interactions highlight the receptor's multifaceted roles in mediating cellular responses to prolactin and underscore its significance in regulating diverse cellular functions.

Measured by its ability to inhibit Prolactin-induced proliferation of Nb2-11 rat lymphoma cells. The ED₅₀ for this effect is 0.01808 µg/mL in the presence of 0.5 ng/mL of recombinant human Prolactin, corresponding to a specific activity is 5.531×10⁴ units/mg.

• 
  Measured by its ability to inhibit Prolactin-induced proliferation of Nb2-11 rat lymphoma cells. The ED₅₀ for this effect is 0.01808 µg/mL in the presence of 0.5 ng/mL of recombinant human Prolactin, corresponding to a specific activity is 5.531×10⁴ units/mg.

Rat

HEK293

C-6*His

P05710 (Q20-D229)

24684  [NCBI]

QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPNDFTLKD

Approximately 32-41 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.