Prostasin/PRSS8 Protein, Human (HEK293, His)

Prostasin/PRSS8, with trypsin-like cleavage specificity, crucially activates the epithelial sodium channel (ENaC) by cleaving its gamma subunits (SCNN1G). This protein forms a heterodimeric complex, consisting of light and heavy chains connected by a disulfide bond. Prostasin/PRSS8 Protein, Human (HEK293, His) is the recombinant human-derived Prostasin/PRSS8 protein, expressed by HEK293 , with C-His labeled tag. The total length of Prostasin/PRSS8 Protein, Human (HEK293, His) is 293 a.a., with molecular weight of ~40 kDa.

Prostasin/PRSS8 protein exhibits trypsin-like cleavage specificity, with a particular affinity for poly-basic substrates. It plays a crucial role in stimulating the activity of the epithelial sodium channel (ENaC) by activating the cleavage of its gamma subunits (SCNN1G). Structurally, it is composed of two chains, a light and a heavy chain, which are held together by a disulfide bond, forming a heterodimeric complex.

Measured by its ability to cleave the fluorogenic peptide substrate Boc-QAR-AMC. The specific activity is 121.6525 pmol/min/µg, as measured under the described conditions.

Human

HEK293

C-His

Q16651 (A30-R322)

5652  [NCBI]

AEGAEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGLLR

Approximately 40 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.