1. Recombinant Proteins
  2. Viral Proteins
  3. HPV Proteins
  4. HPV E6 Proteins
  5. Protein E6, HPV16 (His)

Protein E6 is one of three cancer proteins encoded by human papillomavirus (HPV). The binding of Protein E6 to ubiquitin protein ligase can inhibit the expression of p53. Protein E6 suppresses the immune response through the JAK-STAT signaling pathway. Protein E6 can promote cell proliferation and inhibit cell apoptosis. Protein E6, HPV16 (His) is the recombinant Virus-derived protein E6, HPV16, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Protein E6 is one of three cancer proteins encoded by human papillomavirus (HPV). The binding of Protein E6 to ubiquitin protein ligase can inhibit the expression of p53. Protein E6 suppresses the immune response through the JAK-STAT signaling pathway. Protein E6 can promote cell proliferation and inhibit cell apoptosis. Protein E6, HPV16 (His) is the recombinant Virus-derived protein E6, HPV16, expressed by E. coli , with N-6*His labeled tag.

Background

Protein E6 is an oncoprotein that plays a major role in the induction and maintenance of cell transformation by stimulating many host cell key regulatory proteins. Protein E6 binds to host ubiquitin protein ligase UBE3A/E6-AP to degrade and inactivate tumor suppressors TP53 and TP73 by targeting the 26S proteasome. In turn, DNA damage and chromosomal instability increase, leading to cell proliferation and cancer development. Protein E6 forms complexes that degrade E6/E6AP, including BAK1, Fas associated death domain protein (FADD), and procaspase 8 to inhibit apoptosis. Protein E6 also suppresses the immune response by interacting with host IRF3 and TYK2. These interactions block IRF3 transcriptional activity and inhibit interferon-α-mediated Tyk2-mediated JAK-STAT activation, thereby inhibiting the interferon signaling pathway. Protein E6 activates telomerase in early human keratinocytes and breast epithelial cells. The interaction between Protein E6 and hDLG or other proteins containing the PDZ domain may be a potential mechanism for the development of HPV-associated cancers[1][2][3][4][5].

Biological Activity

Measured in a cell proliferation assay using A549 cells. The ED50  for this effect is <6.8 ng/mL, corresponding to a specific activity is >1.47×105 units/mg.

  • Measured in a cell proliferation assay using A549 cells. The ED50  for this effect is 3.586 ng/mL, corresponding to a specific activity is 2.79×105 units/mg.
Species

Virus

Source

E. coli

Tag

N-6*His

Accession

P03126 (M1-L158)

Gene ID

1489078  [NCBI]

Molecular Construction
N-term
6*His
Protein E6 (M1-L158)
Accession # P03126
C-term
Synonyms
E6; Protein E6
AA Sequence

MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL

Molecular Weight

Approximately 21 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0 or 50 mM Tris-HCL, 200 mM NaCl, 500 mM arginine, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Protein E6, HPV16 (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Protein E6, HPV16 (His)
Cat. No.:
HY-P72260
Quantity:
MCE Japan Authorized Agent: