1. Recombinant Proteins
  2. Viral Proteins
  3. HPV Proteins
  4. HPV E7 Proteins
  5. Protein E7, HPV (N-His, C-His)

Protein E7, HPV, crucially induces quiescent cells to enter the cell cycle, facilitating efficient utilization of cellular DNA replicating machinery for viral genome replication. With transforming and trans-activating activities, E7 disrupts the RB1-E2F1 complex, activating E2F1-regulated S-phase genes. It interferes with host histone deacetylation by HDAC1 and HDAC2, inhibiting antiviral functions of interferon alpha. E7's interaction with host TMEM173/STING hinders sensing cytosolic DNA, repressing type I interferon production. Forming homodimers and homooligomers, E7 associates with RB1, disrupting its activity, and with EP300 to repress transcriptional activity. Complex formation with CHD4 and HDAC1 alters host histone deacetylation, while the interaction with protein E2 inhibits E7 oncogenic activity. E7's multifaceted actions underscore its pivotal role in HPV-associated cellular processes and intricate modulation of host cell functions. Protein E7, HPV (N-His, C-His) is the recombinant Virus-derived protein E7, HPV, expressed by E. coli, with N-6*His, C-6*His labeled tag. The total length of Protein E7, HPV (N-His, C-His) is 98 a.a., with molecular weight of 16.3 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Protein E7, HPV, crucially induces quiescent cells to enter the cell cycle, facilitating efficient utilization of cellular DNA replicating machinery for viral genome replication. With transforming and trans-activating activities, E7 disrupts the RB1-E2F1 complex, activating E2F1-regulated S-phase genes. It interferes with host histone deacetylation by HDAC1 and HDAC2, inhibiting antiviral functions of interferon alpha. E7's interaction with host TMEM173/STING hinders sensing cytosolic DNA, repressing type I interferon production. Forming homodimers and homooligomers, E7 associates with RB1, disrupting its activity, and with EP300 to repress transcriptional activity. Complex formation with CHD4 and HDAC1 alters host histone deacetylation, while the interaction with protein E2 inhibits E7 oncogenic activity. E7's multifaceted actions underscore its pivotal role in HPV-associated cellular processes and intricate modulation of host cell functions. Protein E7, HPV (N-His, C-His) is the recombinant Virus-derived protein E7, HPV, expressed by E. coli, with N-6*His, C-6*His labeled tag. The total length of Protein E7, HPV (N-His, C-His) is 98 a.a., with molecular weight of 16.3 kDa.

Background

The Protein E7 from Human Papillomavirus (HPV) plays a crucial role in viral genome replication by inducing quiescent cells to enter the cell cycle, facilitating the efficient utilization of the cellular DNA replicating machinery for viral genome replication. E7 exhibits both transforming and trans-activating activities, disrupting the RB1-E2F1 complex and activating E2F1-regulated S-phase genes. It interferes with host histone deacetylation mediated by HDAC1 and HDAC2, resulting in transcriptional activation. Additionally, E7 inhibits the antiviral and antiproliferative functions of host interferon alpha. Its interaction with host TMEM173/STING hinders the ability of TMEM173/STING to sense cytosolic DNA and promote type I interferon production. E7 forms homodimers and homooligomers, interacts with host RB1 to disrupt RB1 activity, and associates with EP300 to repress EP300 transcriptional activity. Complex formation with CHD4 and HDAC1 alters host histone deacetylation, while the interaction with protein E2 inhibits E7 oncogenic activity. The multifaceted actions of Protein E7 underscore its pivotal role in HPV-associated cellular processes and its intricate modulation of host cell functions.

Species

Virus

Source

E. coli

Tag

N-6*His;C-6*His

Accession

P03129 (M1-P98)

Gene ID

1489079  [NCBI]

Molecular Construction
N-term
6*His
Protein E7 (M1-P98)
Accession # P03129
6*His
C-term
Synonyms
Protein E7
AA Sequence

MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Molecular Weight

16.3 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Protein E7, HPV (N-His, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Protein E7, HPV (N-His, C-His)
Cat. No.:
HY-P700389
Quantity:
MCE Japan Authorized Agent: