Protein L1/VACWR088, Vaccinia virus (Sf9, His, myc)

Protein L1/VACWR088 is a crucial part of the entry fusion complex (EFC) comprising 11 proteins. It facilitates the entry of the virion core into the host cytoplasm through a two-step process involving lipid mixing and pore formation. All EFC proteins, except OPG095/L1 and OPG053/F9, contribute to the assembly or stability of the complex. Protein L1/VACWR088, Vaccinia virus (Sf9, His, myc) is the recombinant Virus-derived protein L1/VACWR088, expressed by Sf9 insect cells , with N-His, C-Myc labeled tag. The total length of Protein L1/VACWR088, Vaccinia virus (Sf9, His, myc) is 182 a.a., with molecular weight of ~26 kDa.

Protein L1/VACWR088 serves as a crucial component of the entry fusion complex (EFC), a fundamental assembly comprising 11 proteins. During cell infection, this complex plays a pivotal role in facilitating the entry of the virion core into the host cytoplasm through a two-step mechanism involving lipid mixing of the viral and cellular membranes, followed by the formation of a pore. The EFC is orchestrated by a collaborative effort among its constituent proteins, namely OPG053/F9, OPG076/O3, OPG086/G3, OPG094/G9, OPG095/L1, OPG099/L5, OPG107/H2, OPG143/A16, OPG104/J5, OPG147/A21, and OPG155/A28. Remarkably, with the exception of OPG095/L1 and OPG053/F9, each protein within the EFC is indispensable for the assembly or stability of the complex.

Virus

Sf9 insect cells

N-His;C-Myc

P07612 (G2-G183)

3707544  [NCBI]

GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAGTG

Approximately 26 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 3% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.