PRPS2 Protein, Human (HEK293, His)

The PRPS2 protein plays a key role in catalyzing the synthesis of phosphoribosyl pyrophosphate (PRPP), a key intermediate in nucleotide synthesis. By promoting the conversion of ribose 5-phosphate and ATP to PRPP, PRPS2 contributes to the availability of PRPP in various cellular processes, including de novo biosynthesis of purine and pyrimidine nucleotides. PRPS2 Protein, Human (HEK293, His) is the recombinant human-derived PRPS2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of PRPS2 Protein, Human (HEK293, His) is 317 a.a., with molecular weight of ~37.0 kDa.

Phosphoribosylpyrophosphate Synthetase 2 (PRPS2) is an enzyme crucial for nucleotide biosynthesis as it catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP). PRPP serves as a key precursor in the de novo biosynthesis of purine and pyrimidine nucleotides, essential for DNA and RNA synthesis. The enzymatic activity of PRPS2 involves the transfer of pyrophosphate from ATP to ribose 5-phosphate, forming PRPP. This reaction represents a critical step in the purine and pyrimidine salvage pathways, providing the necessary building blocks for cellular nucleotide pools. The role of PRPS2 in synthesizing PRPP underscores its significance in supporting fundamental cellular processes, including the maintenance of genetic material and cellular proliferation.

Human

HEK293

C-6*His

P11908 (P2-L318)

5634  [NCBI]

PNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTIPQEDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL

Approximately 37.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.