PRTN3 Protein, Human (HEK293, His)

PRTN3 is a serine protease that broadly targets elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV in vitro, playing a crucial role in extracellular matrix degradation. It modulates endothelial cell barrier function by cleaving and activating the receptor F2RL1/PAR-2 and enhances vascular integrity during neutrophil transendothelial migration. PRTN3 Protein, Human (HEK293, His) is the recombinant human-derived PRTN3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of PRTN3 Protein, Human (HEK293, His) is 224 a.a., with molecular weight of ~34.0 kDa.

PRTN3, a serine protease, exhibits a broad substrate specificity, targeting elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV in vitro. Its enzymatic activity plays a crucial role in the degradation of these extracellular matrix components. Additionally, PRTN3 takes part in the modulation of endothelial cell barrier function by cleaving and activating the receptor F2RL1/PAR-2, thereby enhancing vascular integrity during neutrophil transendothelial migration. Notably, its potential involvement in neutrophil transendothelial migration is suggested, particularly when associated with CD177, emphasizing its significance in immune-related processes.

Human

HEK293

C-6*His

P24158(A26-R249)

5657  [NCBI]

AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRR

Approximately 34.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 10 mM Tris-HCl, 150 mM NaCl, 10% Glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.