PRTN3 Protein, Human (HEK293, C-His)

PRTN3 is a serine protease that broadly targets elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV in vitro, playing a crucial role in extracellular matrix degradation.It modulates endothelial cell barrier function by cleaving and activating the receptor F2RL1/PAR-2 and enhances vascular integrity during neutrophil transendothelial migration.PRTN3 Protein, Human (HEK293, C-His) is the recombinant human-derived PRTN3 protein, expressed by HEK293 , with C-6*His labeled tag.

PRTN3, a serine protease, exhibits a broad substrate specificity, targeting elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV in vitro. Its enzymatic activity plays a crucial role in the degradation of these extracellular matrix components. Additionally, PRTN3 takes part in the modulation of endothelial cell barrier function by cleaving and activating the receptor F2RL1/PAR-2, thereby enhancing vascular integrity during neutrophil transendothelial migration. Notably, its potential involvement in neutrophil transendothelial migration is suggested, particularly when associated with CD177, emphasizing its significance in immune-related processes.

Human

HEK293

C-6*His

P24158 (A26-R249)

5657

AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRR

Approximately 34.0 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 10 mM Tris-HCL, 150 mM NaCl, pH 8.0, 10% Glycerol, 10% trehalose, 0.02% Tween80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.