PSAT1 Protein, Human (His)

The PSAT1 protein plays a central role in cellular metabolism by catalyzing the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and 3-hydroxy-2-oxo-4-phosphonooxybutyrate to phosphohydroxythreonine. These enzyme activities are key steps in the biosynthetic pathway of the essential amino acids serine and threonine. PSAT1 Protein, Human (His) is the recombinant human-derived PSAT1 protein, expressed by E. coli , with C-6*His labeled tag. The total length of PSAT1 Protein, Human (His) is 370 a.a., with molecular weight of ~40 kDa.

The PSAT1 (Phosphoserine aminotransferase 1) protein is an enzyme that catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine. This enzymatic activity is a key step in the serine biosynthetic pathway, contributing to the synthesis of essential amino acids and cellular processes such as nucleotide and protein biosynthesis. Phosphoserine and phosphohydroxythreonine generated by PSAT1 serve as precursors for the production of serine and glycine, both of which are crucial for various metabolic pathways and cellular functions. PSAT1's role in serine biosynthesis underscores its importance in maintaining cellular homeostasis and provides potential insights into therapeutic approaches for conditions involving dysregulated amino acid metabolism.

Measured by its ability to produce 3-phosphooxypyruvate. The specific activity is >130 pmol/min/μg.

Human

E. coli

C-6*His

Q9Y617-1 (M1-L370)

29968  [NCBI]

MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL

Approximately 40 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.