1. Recombinant Proteins
  2. Others
  3. PSCA Protein, Mouse (P.pastoris, His)

PSCA protein is a multifunctional regulator that may modulate cell proliferation and act as a modulator of nicotinic acetylcholine receptor (nAChR) activity. In vitro experiments showed that it can inhibit nicotine-induced signaling, suggesting interaction with nAChR containing α-3:β-2 or α-7. PSCA Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived PSCA protein, expressed by P. pastoris , with N-His labeled tag. The total length of PSCA Protein, Mouse (P.pastoris, His) is 75 a.a., with molecular weight of ~10.4 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PSCA protein is a multifunctional regulator that may modulate cell proliferation and act as a modulator of nicotinic acetylcholine receptor (nAChR) activity. In vitro experiments showed that it can inhibit nicotine-induced signaling, suggesting interaction with nAChR containing α-3:β-2 or α-7. PSCA Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived PSCA protein, expressed by P. pastoris , with N-His labeled tag. The total length of PSCA Protein, Mouse (P.pastoris, His) is 75 a.a., with molecular weight of ~10.4 kDa.

Background

The PSCA protein emerges as a versatile regulator, potentially involved in the modulation of cell proliferation and acting as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro experiments demonstrate its ability to inhibit nicotine-induced signaling, suggesting a potential interaction with alpha-3:beta-2- or alpha-7-containing nAChRs. The dual functionality of PSCA, influencing both cell proliferation and nicotinic acetylcholine receptor activity, underscores its significance in cellular processes and signaling pathways, hinting at its potential role in the intricate balance of cellular homeostasis.

Species

Mouse

Source

P. pastoris

Tag

N-His

Accession

P57096 (21L-95N)

Gene ID
Molecular Construction
N-term
His
PSCA (21L-95N)
Accession # P57096
C-term
Synonyms
Psca; Prostate stem cell antigen
AA Sequence

LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN

Molecular Weight

Approximately 10.4 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PSCA Protein, Mouse (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PSCA Protein, Mouse (P.pastoris, His)
Cat. No.:
HY-P71775
Quantity:
MCE Japan Authorized Agent: