PSCA Protein, Mouse (P.pastoris, His)

PSCA protein is a multifunctional regulator that may modulate cell proliferation and act as a modulator of nicotinic acetylcholine receptor (nAChR) activity. In vitro experiments showed that it can inhibit nicotine-induced signaling, suggesting interaction with nAChR containing α-3:β-2 or α-7. PSCA Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived PSCA protein, expressed by P. pastoris , with N-His labeled tag. The total length of PSCA Protein, Mouse (P.pastoris, His) is 75 a.a., with molecular weight of ~10.4 kDa.

The PSCA protein emerges as a versatile regulator, potentially involved in the modulation of cell proliferation and acting as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro experiments demonstrate its ability to inhibit nicotine-induced signaling, suggesting a potential interaction with alpha-3:beta-2- or alpha-7-containing nAChRs. The dual functionality of PSCA, influencing both cell proliferation and nicotinic acetylcholine receptor activity, underscores its significance in cellular processes and signaling pathways, hinting at its potential role in the intricate balance of cellular homeostasis.

Mouse

P. pastoris

N-His

P57096 (21L-95N)

72373  [NCBI]

LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN

Approximately 10.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.