1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Carboxypeptidase
  4. PSME1 Protein, Human (His)

The PSME1 protein is critical for immunoproteasome assembly and is essential for efficient antigen processing. As part of the PA28 activator complex, PSME1, together with PSME2, actively enhances the production of class I binding peptides by altering the cleavage pattern of the proteasome. PSME1 Protein, Human (His) is the recombinant human-derived PSME1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of PSME1 Protein, Human (His) is 248 a.a., with molecular weight of ~29 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PSME1 protein is critical for immunoproteasome assembly and is essential for efficient antigen processing. As part of the PA28 activator complex, PSME1, together with PSME2, actively enhances the production of class I binding peptides by altering the cleavage pattern of the proteasome. PSME1 Protein, Human (His) is the recombinant human-derived PSME1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of PSME1 Protein, Human (His) is 248 a.a., with molecular weight of ~29 kDa.

Background

PSME1 Protein plays a pivotal role in immunoproteasome assembly and is crucial for efficient antigen processing. As a component of the PA28 activator complex, PSME1, along with PSME2, actively enhances the production of class I binding peptides by modulating the cleavage pattern of the proteasome. Together, the PSME1 and PSME2 heterodimer forms a hexameric ring structure integral to these immunoproteasome functions. Additionally, PSME1 has the capacity to form homoheptamers, further emphasizing its role in orchestrating immune responses and antigen presentation.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q06323 (A2-Y249)

Gene ID
Molecular Construction
N-term
6*His
PSME1 (A2-Y249)
Accession # Q06323
C-term
Synonyms
Proteasome activator complex subunit 1; REG-alpha; IGUP I-5111; PA28a; IFI5111
AA Sequence

AMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY

Molecular Weight

Approximately 29 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of sterile 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween 80, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PSME1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PSME1 Protein, Human (His)
Cat. No.:
HY-P75990
Quantity:
MCE Japan Authorized Agent: