PTH Protein, Human (HEK293, His)

PTH Protein, or parathyroid hormone, raises calcium levels by dissolving bone salts and inhibiting kidney excretion. It also stimulates [1-14C]-2-deoxy-D-glucose transport and glycogen synthesis in osteoblastic cells, interacting with the PTH1R receptor and binding to its N-terminal extracellular domain for these effects. PTH Protein, Human (HEK293, His) is the recombinant human-derived PTH protein, expressed by HEK293 , with N-8*His labeled tag. The total length of PTH Protein, Human (HEK293, His) is 84 a.a., with molecular weight of ~15 kDa.

PTH, or parathyroid hormone, functions to increase calcium levels by facilitating the dissolution of bone salts and inhibiting their excretion by the kidneys. Additionally, it stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and promotes glycogen synthesis in osteoblastic cells. PTH achieves these effects through its interaction with the PTH1R receptor, specifically binding to the N-terminal extracellular domain of the receptor.

Measured by its ability to alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells.  The ED₅₀ this effect is 7.273 ng/mL, corresponding to a specific activity is 1.375×10⁵ units/mg.

• 
  Measured by its ability to alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED₅₀ for this effect is 8.814 ng/mL, corresponding to a specific activity is 1.135×10⁵ units/mg.

Human

HEK293

N-8*His

P01270 (S32-Q115)

5741  [NCBI]

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

Approximately 15 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.