1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. PTH Protein, Human (HEK293, His)

PTH Protein, or parathyroid hormone, raises calcium levels by dissolving bone salts and inhibiting kidney excretion. It also stimulates [1-14C]-2-deoxy-D-glucose transport and glycogen synthesis in osteoblastic cells, interacting with the PTH1R receptor and binding to its N-terminal extracellular domain for these effects. PTH Protein, Human (HEK293, His) is the recombinant human-derived PTH protein, expressed by HEK293 , with N-8*His labeled tag. The total length of PTH Protein, Human (HEK293, His) is 84 a.a., with molecular weight of ~15 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PTH Protein, or parathyroid hormone, raises calcium levels by dissolving bone salts and inhibiting kidney excretion. It also stimulates [1-14C]-2-deoxy-D-glucose transport and glycogen synthesis in osteoblastic cells, interacting with the PTH1R receptor and binding to its N-terminal extracellular domain for these effects. PTH Protein, Human (HEK293, His) is the recombinant human-derived PTH protein, expressed by HEK293 , with N-8*His labeled tag. The total length of PTH Protein, Human (HEK293, His) is 84 a.a., with molecular weight of ~15 kDa.

Background

PTH, or parathyroid hormone, functions to increase calcium levels by facilitating the dissolution of bone salts and inhibiting their excretion by the kidneys. Additionally, it stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and promotes glycogen synthesis in osteoblastic cells. PTH achieves these effects through its interaction with the PTH1R receptor, specifically binding to the N-terminal extracellular domain of the receptor.

Biological Activity

Measured by its ability to alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells.  The ED50 this effect is 7.273 ng/mL, corresponding to a specific activity is 1.375×105 units/mg.

  • Measured by its ability to alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED50 for this effect is 8.814 ng/mL, corresponding to a specific activity is 1.135×105 units/mg.
Species

Human

Source

HEK293

Tag

N-8*His

Accession

P01270 (S32-Q115)

Gene ID
Molecular Construction
N-term
8*His
PTH (S32-Q115)
Accession # P01270
C-term
Synonyms
Parathyroid hormone; PTH; Parathormone; Parathyrin; PTH
AA Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

Molecular Weight

Approximately 15 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

PTH Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PTH Protein, Human (HEK293, His)
Cat. No.:
HY-P71060
Quantity:
MCE Japan Authorized Agent: