PTH Protein, Human

PTH Protein, Human is a major regulator of mineral ion metabolism.

Recombinant Human Parathyroid Hormone is a replica of the endogenous Parathyroid hormone molecule. Parathyroid Hormone regulates calcium and phosphorus levels by acting on the bone, kidneys and intestines. In the bone, Parathyroid hormone mobilizes calcium and phosphorus into the circulation by stimulating bone resorption. Parathyroid hormone stimulates osteoblasts to increase the expression of receptor activator of nuclear factor j-B ligand (RANKL)^[1].

1.PTH is fully biologically active when compared to standards. The activity calculated by UMR106 cell/cAMP method corresponding to a specifc activity of 1.0×10⁴ U/mg.
2.Measured by its ability to induce cAMP accumulation in MC3T3‑E1 mouse preosteoblast cells. The ED₅₀ for this effect is 26.74 ng/mL, corresponding to a specific activity is 3.739×10⁴ U/mg.

• 
  Measured by its ability to induce cAMP accumulation in MC3T3-E1 mouse preosteoblast cells. The ED₅₀ for this effect is 26.74 ng/mL, corresponding to a specific activity is 3.739×10⁴ U/mg.

Human

E. coli

Tag Free

P01270 (S32-Q115)

5741  [NCBI]

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

Approximately 9-15 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against 1.15 mg sodium citrate, sodium chloride 7.31 mg, 0.21 mg citric acid, 0.1117 mg EDTA-Na₂, 0.2 mg Tween 80 and 50 mg Mannitol or 10 mM HAc-NaAc, 150 mM NaCl, 5% Mannitol, pH 4.0 or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Kim ES, et al. Recombinant Human Parathyroid Hormone (1-84): A Review in Hypoparathyroidism. Drugs. 2015 Jul;75(11):1293-303.  [Content Brief]