PTRH2 Protein, Human (His)

PTRH2, an enzyme with potential peptidyl-tRNA affinity, promotes caspase-independent apoptosis. It regulates transcriptional regulators AES and TLE1, contributing to the intricate machinery governing apoptotic processes. PTRH2 Protein, Human (His) is the recombinant human-derived PTRH2 protein, expressed by E. coli , with N-His labeled tag. The total length of PTRH2 Protein, Human (His) is 117 a.a., with molecular weight of ~14 kDa.

PTRH2, an enzyme with a potential affinity for peptidyl-tRNAs that dissociate from the ribosome during protein synthesis, is implicated in the promotion of caspase-independent apoptosis. Its regulatory role extends to the modulation of two transcriptional regulators, AES and TLE1, contributing to the intricate machinery that governs apoptotic processes.

Measured by its ability to inhibit chemoattract of A549 Human non-small cell lung cancer cells. The ED₅₀ for this effect is 0.1557 μg/mL, corresponding to a specific activity is 6.422×10³ U/mg.

Human

E. coli

N-His

Q9Y3E5 (G63-Y179)

51651  [NCBI]

GEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY

Approximately 14 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 8.0, 10% Glycerol.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.