PVALB Protein, Human (His)

PVALB Protein, also known as parvalbumin, plays a key role in muscle tissue by facilitating relaxation after contraction. Its function involves binding two calcium ions, indicating a crucial role in regulating calcium dynamics within muscle cells. Parvalbumin's ability to sequester calcium underscores its significance in fine-tuning the balance between contraction and relaxation, contributing to overall muscle physiology control. PVALB Protein, Human (His) is the recombinant human-derived PVALB protein, expressed by E. coli , with C-6*His labeled tag. The total length of PVALB Protein, Human (His) is 109 a.a., with molecular weight of ~14.0 kDa.

In muscle tissue, the PVALB protein, commonly known as parvalbumin, is implicated in the process of relaxation following contraction. Its functional role centers on binding two calcium ions, suggesting a crucial involvement in regulating calcium dynamics within muscle cells. This capacity to sequester calcium underscores parvalbumin's significance in fine-tuning the intricate balance between contraction and relaxation, contributing to the overall control of muscle physiology.

Human

E. coli

C-6*His

P20472 (S2-S110)

5816  [NCBI]

SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES

Approximately 14.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.