QDPR Protein, Human (HEK293, His)

The QDPR protein plays a crucial role in cellular biopterin metabolism as it catalyzes the conversion of the quinone dihydrobiopterin into tetrahydrobiopterin. This enzymatic process is essential for the regeneration and recycling of tetrahydrobiopterin, a necessary cofactor for various enzymatic reactions, especially those involved in neurotransmitter synthesis and nitric oxide production Enzymatic reaction. QDPR Protein, Human (HEK293, His) is the recombinant human-derived QDPR protein, expressed by HEK293 , with C-6*His labeled tag. The total length of QDPR Protein, Human (HEK293, His) is 243 a.a., with molecular weight of ~29.0 kDa.

Quinoid dihydropteridine reductase (QDPR) is an enzyme that plays a critical role in the metabolism of biopterin compounds. Specifically, QDPR catalyzes the conversion of quinonoid dihydrobiopterin into tetrahydrobiopterin, a crucial cofactor in various biological processes. Tetrahydrobiopterin is involved in the synthesis of neurotransmitters, such as serotonin and dopamine, and serves as a cofactor for enzymes like phenylalanine hydroxylase, which is essential for amino acid metabolism. By facilitating the reduction of quinonoid dihydrobiopterin, QDPR contributes to the recycling and regeneration of tetrahydrobiopterin, ensuring its availability for various cellular processes. It has to highlight QDPR's specific catalytic function in the biopterin pathway, emphasizing its importance in maintaining the balance of biopterin cofactors critical for neurotransmitter synthesis and other essential biochemical reactions.

Human

HEK293

C-6*His

P09417 (A2-F244)

5860  [NCBI]

AAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF

Approximately 29.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.