1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. QPCT Protein, Mouse (HEK293, His)

The QPCT protein plays a key role in pyroglutamyl peptide biosynthesis and exhibits substrate preference for N-terminal glutamine residues while showing specificity for residues near the N-terminus. Notably, its catalytic activity is independent of chain length beyond the second residue, emphasizing the importance of QPCT in the precise biosynthesis of pyroglutamyl peptides with diverse N-termini, contributing to various biological background. QPCT Protein, Mouse (HEK293, His) is the recombinant mouse-derived QPCT protein, expressed by HEK293 , with N-His, N-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The QPCT protein plays a key role in pyroglutamyl peptide biosynthesis and exhibits substrate preference for N-terminal glutamine residues while showing specificity for residues near the N-terminus. Notably, its catalytic activity is independent of chain length beyond the second residue, emphasizing the importance of QPCT in the precise biosynthesis of pyroglutamyl peptides with diverse N-termini, contributing to various biological background. QPCT Protein, Mouse (HEK293, His) is the recombinant mouse-derived QPCT protein, expressed by HEK293 , with N-His, N-Myc labeled tag.

Background

The QPCT protein plays a pivotal role in the biosynthesis of pyroglutamyl peptides, exhibiting a preference for substrates with an N-terminal glutaminyl residue while displaying a bias against adjacent acidic and tryptophan residues. Notably, its substrate specificity is more pronounced for the residues proximal to the N-terminal glutaminyl residue, showing a distinctive substrate recognition pattern. Additionally, QPCT demonstrates a lack of significant dependence on chain length beyond the second residue, suggesting that the protein's catalytic activity is less influenced by elongation beyond this point. This selectivity and flexibility in substrate recognition highlight QPCT's significance in the precise biosynthesis of pyroglutamyl peptides, contributing to the diverse array of peptides with pyroglutamylated N-termini in various biological contexts.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Mouse

Source

HEK293

Tag

N-His;N-Myc

Accession

Q9CYK2-1 (A36-L362)

Gene ID
Molecular Construction
N-term
6*His-SUMO
QPCT (A36-L362)
Accession # Q9CYK2-1
C-term
Synonyms
Qpct; Glutaminyl-peptide cyclotransferase; EC 2.3.2.5; Glutaminyl cyclase; QC; Glutaminyl-tRNA cyclotransferase
AA Sequence

AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL

Molecular Weight

Approximately 41.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against solution in 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

QPCT Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
QPCT Protein, Mouse (HEK293, His)
Cat. No.:
HY-P71670
Quantity:
MCE Japan Authorized Agent: