1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. RAB5C, Human (HEK293, His)

IL5 Protein is a cytokine that plays a critical role in regulating immune responses, particularly in promoting the production and activation of eosinophils. It is involved in modulating allergic and inflammatory processes. Dysregulation of IL5 Protein has been associated with various diseases, including asthma and allergic rhinitis. Targeting IL5 Protein may offer potential therapeutic interventions in these conditions by inhibiting eosinophil activation and reducing inflammation. RAB5C, Human (HEK293, His) is the recombinant human-derived RAB5C, expressed by HEK293, with C-His labeled tag. The total length of RAB5C, Human (HEK293, His) is 216 a.a., with molecular weight of ~25 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL5 Protein is a cytokine that plays a critical role in regulating immune responses, particularly in promoting the production and activation of eosinophils. It is involved in modulating allergic and inflammatory processes. Dysregulation of IL5 Protein has been associated with various diseases, including asthma and allergic rhinitis. Targeting IL5 Protein may offer potential therapeutic interventions in these conditions by inhibiting eosinophil activation and reducing inflammation. RAB5C, Human (HEK293, His) is the recombinant human-derived RAB5C, expressed by HEK293, with C-His labeled tag. The total length of RAB5C, Human (HEK293, His) is 216 a.a., with molecular weight of ~25 kDa.

Background

RAB5C, a member of the Rab protein family, is a small GTPase of the Ras superfamily that is believed to play a role in ensuring the accuracy of vesicle docking and/or fusion with their appropriate acceptor compartment. It is ubiquitously expressed in various tissues, including the kidney (RPKM 55.2), bone marrow (RPKM 47.2), and 25 other tissues.

Species

Human

Source

HEK293

Tag

C-His

Accession

NP_958842 (M1-N216)

Gene ID

5878

Molecular Construction
N-term
RAB5C (M1-N216)
Accession # NP_958842
His
C-term
Synonyms
L1880; RAB5CL; RAB5L; RABL
AA Sequence

MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN

Molecular Weight

Approximately 25 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

RAB5C, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RAB5C, Human (HEK293, His)
Cat. No.:
HY-P701131
Quantity:
MCE Japan Authorized Agent: