RAB5C, Human (HEK293, His)

IL5 Protein is a cytokine that plays a critical role in regulating immune responses, particularly in promoting the production and activation of eosinophils. It is involved in modulating allergic and inflammatory processes. Dysregulation of IL5 Protein has been associated with various diseases, including asthma and allergic rhinitis. Targeting IL5 Protein may offer potential therapeutic interventions in these conditions by inhibiting eosinophil activation and reducing inflammation. RAB5C, Human (HEK293, His) is the recombinant human-derived RAB5C, expressed by HEK293, with C-His labeled tag. The total length of RAB5C, Human (HEK293, His) is 216 a.a., with molecular weight of ~25 kDa.

RAB5C, a member of the Rab protein family, is a small GTPase of the Ras superfamily that is believed to play a role in ensuring the accuracy of vesicle docking and/or fusion with their appropriate acceptor compartment. It is ubiquitously expressed in various tissues, including the kidney (RPKM 55.2), bone marrow (RPKM 47.2), and 25 other tissues.

Human

HEK293

C-His

NP_958842 (M1-N216)

5878

MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN

Approximately 25 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.