RBP2 Protein, Human

RBP2 is pivotal for intracellular retinol transport. RBP2 Protein, Human is the recombinant human-derived RBP2 protein, expressed by E. coli , with tag free. The total length of RBP2 Protein, Human is 134 a.a., with molecular weight of ~16.78 kDa.

RBP2 plays a crucial role in the intracellular transport of retinol.

Human

E. coli

Tag Free

P50120 (M1-K134)

5948  [NCBI]

MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK

Approximately 16.78 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.