RBP3 Protein, Human (His)

RBP3 Protein, or interphotoreceptor retinoid-binding protein (IRBP), crucially facilitates the transport of retinoids between retinol isomerase and visual pigments in the retina. Its role is essential for maintaining the visual pathway's integrity, ensuring proper synthesis and regeneration of visual pigments crucial for vision. RBP3 Protein, Human (His) is the recombinant human-derived RBP3 protein, expressed by E. coli , with N-6*His labeled tag. The total length of RBP3 Protein, Human (His) is 310 a.a., with molecular weight of 38 & 75-80 kDa, respectively.

RBP3, known as interphotoreceptor retinoid-binding protein (IRBP), plays a crucial role in the visual system by facilitating the transport of 11-cis and all-trans retinoids between the retinol isomerase in the pigment epithelium and the visual pigments within the photoreceptor cells of the retina. Its role in shuttling retinoids is essential for maintaining the integrity and function of the visual pathway, ensuring the proper synthesis and regeneration of visual pigments crucial for vision.

Human

E. coli

N-6*His

P10745 (T321-L630)

5949  [NCBI]

TLRSALPGVVHCLQEVLKDYYTLVDRVPTLLQHLASMDFSTVVSEEDLVTKLNAGLQAASEDPRLLVRAIGPTETPSWPAPDAAAEDSPGVAPELPEDEAIRQALVDSVFQVSVLPGNVGYLRFDSFADASVLGVLAPYVLRQVWEPLQDTEHLIMDLRHNPGGPSSAVPLLLSYFQGPEAGPVHLFTTYDRRTNITQEHFSHMELPGPRYSTQRGVYLLTSHRTATAAEEFAFLMQSLGWATLVGEITAGNLLHTRTVPLLDTPEGSLALTVPVLTFIDNHGEAWLGGGVVPDAIVLAEEALDKAQEVL

38&75-80 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.