RCN3 Protein, Mouse (HEK293, His)

RCN3 Protein, a probable molecular chaperone, ensures pulmonary surfactant homeostasis by aiding in proper biosynthesis and transport of SP-A, SP-D, and ABCA3. It exhibits anti-fibrotic activity by negatively regulating type I and type III collagen secretion. RCN3 transiently associates with immature PCSK6, suggesting its role in PCSK6 maturation and secretion. RCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived RCN3 protein, expressed by HEK293 , with C-His labeled tag. The total length of RCN3 Protein, Mouse (HEK293, His) is 308 a.a., with molecular weight of ~36.9 KDa.

RCN3 Protein is a probable molecular chaperone that assists in protein biosynthesis and transport within the endoplasmic reticulum, playing a crucial role in maintaining pulmonary surfactant homeostasis by ensuring the proper biosynthesis and transport of pulmonary surfactant-associated proteins A/SP-A, D/SP-D, and the lipid transporter ABCA3. Additionally, it exhibits anti-fibrotic activity by negatively regulating the secretion of type I and type III collagens. Furthermore, RCN3 Protein transiently associates with immature PCSK6 and regulates its secretion, suggesting its involvement in the maturation and secretion of PCSK6.

Mouse

HEK293

C-His

Q8BH97 (K21-L328)

52377  [NCBI]

KPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDEL

Approximately 48 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.