1. Recombinant Proteins
  2. Others
  3. RCN3 Protein, Rat (HEK293, His)

The RCN3 protein is a possible molecular chaperone critical for protein biosynthesis and transport within the endoplasmic reticulum. Its involvement extends to the biosynthesis and transport of key proteins, including SP-A, SP-D, and ABCA3, highlighting the importance of pulmonary surfactant homeostasis. RCN3 Protein, Rat (HEK293, His) is the recombinant rat-derived RCN3 protein, expressed by HEK293 , with C-His labeled tag. The total length of RCN3 Protein, Rat (HEK293, His) is 304 a.a., with molecular weight of ~36.4 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The RCN3 protein is a possible molecular chaperone critical for protein biosynthesis and transport within the endoplasmic reticulum. Its involvement extends to the biosynthesis and transport of key proteins, including SP-A, SP-D, and ABCA3, highlighting the importance of pulmonary surfactant homeostasis. RCN3 Protein, Rat (HEK293, His) is the recombinant rat-derived RCN3 protein, expressed by HEK293 , with C-His labeled tag. The total length of RCN3 Protein, Rat (HEK293, His) is 304 a.a., with molecular weight of ~36.4 KDa.

Background

The RCN3 protein is implicated as a probable molecular chaperone, playing a crucial role in assisting protein biosynthesis and transport within the endoplasmic reticulum. Its involvement extends to the proper biosynthesis and transport of key proteins, including pulmonary surfactant-associated protein A/SP-A, pulmonary surfactant-associated protein D/SP-D, and the lipid transporter ABCA3, highlighting its significance in pulmonary surfactant homeostasis. Moreover, RCN3 demonstrates anti-fibrotic activity by negatively regulating the secretion of type I and type III collagens. Notably, this calcium-binding protein transiently associates with immature PCSK6, regulating its secretion and suggesting a role in the maturation and secretion processes of PCSK6. The multifaceted functions of RCN3 underscore its importance in maintaining cellular homeostasis, particularly in the context of protein biosynthesis, secretion, and anti-fibrotic processes.

Species

Rat

Source

HEK293

Tag

C-His

Accession

I6L9G5 (K21-H324)

Gene ID
Molecular Construction
N-term
RCN3 (K21-H324)
Accession # I6L9G5
His
C-term
Synonyms
Reticulocalbin-3; EF-Hand Calcium-Binding Protein RLP49; RCN3
AA Sequence

KPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDQLTPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRH

Molecular Weight

Approximately 40-50 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

RCN3 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RCN3 Protein, Rat (HEK293, His)
Cat. No.:
HY-P77476
Quantity:
MCE Japan Authorized Agent: