RCN3 Protein, Rat (HEK293, His)

The RCN3 protein is a possible molecular chaperone critical for protein biosynthesis and transport within the endoplasmic reticulum. Its involvement extends to the biosynthesis and transport of key proteins, including SP-A, SP-D, and ABCA3, highlighting the importance of pulmonary surfactant homeostasis. RCN3 Protein, Rat (HEK293, His) is the recombinant rat-derived RCN3 protein, expressed by HEK293 , with C-His labeled tag. The total length of RCN3 Protein, Rat (HEK293, His) is 304 a.a., with molecular weight of ~36.4 KDa.

The RCN3 protein is implicated as a probable molecular chaperone, playing a crucial role in assisting protein biosynthesis and transport within the endoplasmic reticulum. Its involvement extends to the proper biosynthesis and transport of key proteins, including pulmonary surfactant-associated protein A/SP-A, pulmonary surfactant-associated protein D/SP-D, and the lipid transporter ABCA3, highlighting its significance in pulmonary surfactant homeostasis. Moreover, RCN3 demonstrates anti-fibrotic activity by negatively regulating the secretion of type I and type III collagens. Notably, this calcium-binding protein transiently associates with immature PCSK6, regulating its secretion and suggesting a role in the maturation and secretion processes of PCSK6. The multifaceted functions of RCN3 underscore its importance in maintaining cellular homeostasis, particularly in the context of protein biosynthesis, secretion, and anti-fibrotic processes.

Rat

HEK293

C-His

I6L9G5 (K21-H324)

494125  [NCBI]

KPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDQLTPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRH

Approximately 40-50 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.