1. Recombinant Proteins
  2. Others
  3. RecR Protein, E.coli (His-SUMO)

RecR protein potentially plays a vital role in DNA repair, especially in RecBC-independent recombinational processes. It collaborates with RecF and RecO, suggesting its involvement in cooperative interactions within the cellular machinery dedicated to DNA repair. Further investigation is needed to elucidate RecR's precise functions and molecular interactions in maintaining genomic integrity through DNA repair. RecR Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RecR protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of RecR Protein, E.coli (His-SUMO) is 201 a.a., with molecular weight of ~38.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RecR protein potentially plays a vital role in DNA repair, especially in RecBC-independent recombinational processes. It collaborates with RecF and RecO, suggesting its involvement in cooperative interactions within the cellular machinery dedicated to DNA repair. Further investigation is needed to elucidate RecR's precise functions and molecular interactions in maintaining genomic integrity through DNA repair. RecR Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RecR protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of RecR Protein, E.coli (His-SUMO) is 201 a.a., with molecular weight of ~38.0 kDa.

Background

The RecR protein is suggested to potentially play a vital role in DNA repair, particularly in a RecBC-independent recombinational process. It appears to be intricately involved in facilitating DNA repair mechanisms, and it may operate in conjunction with RecF and RecO, highlighting potential collaborative interactions within the cellular machinery dedicated to DNA repair processes. The specific mechanisms and contexts in which RecR operates in the recombinational repair pathway remain subjects of interest, underscoring the need for further investigation to elucidate its precise functions and molecular interactions in maintaining genomic integrity through DNA repair.

Species

E.coli

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

P0A7H6 (M1-F201)

Gene ID

66671226  [NCBI]

Molecular Construction
N-term
6*His-SUMO
RecR (M1-F201)
Accession # P0A7H6
C-term
Synonyms
recR; b0472; JW0461; Recombination protein RecR
AA Sequence

MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF

Molecular Weight

Approximately 38.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

RecR Protein, E.coli (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RecR Protein, E.coli (His-SUMO)
Cat. No.:
HY-P71490
Quantity:
MCE Japan Authorized Agent: