RecR Protein, E.coli (His-SUMO)

RecR protein potentially plays a vital role in DNA repair, especially in RecBC-independent recombinational processes. It collaborates with RecF and RecO, suggesting its involvement in cooperative interactions within the cellular machinery dedicated to DNA repair. Further investigation is needed to elucidate RecR's precise functions and molecular interactions in maintaining genomic integrity through DNA repair. RecR Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RecR protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of RecR Protein, E.coli (His-SUMO) is 201 a.a., with molecular weight of ~38.0 kDa.

The RecR protein is suggested to potentially play a vital role in DNA repair, particularly in a RecBC-independent recombinational process. It appears to be intricately involved in facilitating DNA repair mechanisms, and it may operate in conjunction with RecF and RecO, highlighting potential collaborative interactions within the cellular machinery dedicated to DNA repair processes. The specific mechanisms and contexts in which RecR operates in the recombinational repair pathway remain subjects of interest, underscoring the need for further investigation to elucidate its precise functions and molecular interactions in maintaining genomic integrity through DNA repair.

E.coli

E. coli

N-SUMO;N-6*His

P0A7H6 (M1-F201)

66671226  [NCBI]

MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF

Approximately 38.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.