REG1B Protein, Rhesus Macaque (HEK293, His)

REG1B Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived REG1B protein, expressed by HEK293 , with C-His labeled tag. The total length of REG1B Protein, Rhesus Macaque (HEK293, His) is 144 a.a., with molecular weight of ~17.7 KDa.

Measured in a cell proliferation assay using RT4-D6P2T rat schwannoma cells. The ED₅₀ for this effect is 0.4012 μg/mL, corresponding to a specific activity is 2.492×10³ units/mg.

Rhesus Macaque

HEK293

C-His

NP_001181497.1 (Q23-N166)

711725  [NCBI]

QETQTELPNARISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSGNLVSVLTEAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDIGAPSSANAGYCASLTSCSGFKKWKDESCEKKFSFVCKFKN

Approximately 17.7 kDa.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.