1. Recombinant Proteins
  2. Others
  3. REG-3 gamma/REG3G Protein, Human (HEK293, His)

REG-3 gamma/REG3G Protein, Human (HEK293, His)

Cat. No.: HY-P71256
Handling Instructions Technical Support

REG-3 gamma/REG3G protein is a bactericidal C-type lectin that specifically targets Gram-positive bacteria by binding to the peptidoglycan surface moiety, mediating bacterial killing. It limits bacterial colonization of intestinal epithelial surfaces and limits microbiota-induced adaptive immune responses. REG-3 gamma/REG3G Protein, Human (HEK293, His) is the recombinant human-derived REG-3 gamma/REG3G protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

REG-3 gamma/REG3G protein is a bactericidal C-type lectin that specifically targets Gram-positive bacteria by binding to the peptidoglycan surface moiety, mediating bacterial killing. It limits bacterial colonization of intestinal epithelial surfaces and limits microbiota-induced adaptive immune responses. REG-3 gamma/REG3G Protein, Human (HEK293, His) is the recombinant human-derived REG-3 gamma/REG3G protein, expressed by HEK293 , with C-6*His labeled tag.

Background

REG-3 gamma/REG3G Protein, a bactericidal C-type lectin, acts exclusively against Gram-positive bacteria by binding to surface-exposed carbohydrate moieties of peptidoglycan, thereby mediating bacterial killing. This protein restricts bacterial colonization of the intestinal epithelial surface, consequently limiting the activation of adaptive immune responses by the microbiota. It functions as a hormone in response to various stimuli, including anti-inflammatory signals like IL17A or the gut microbiome. REG-3 gamma/REG3G Protein is secreted by different cell types to activate its receptor EXTL3, leading to the induction of cell-specific signaling pathways. In keratinocytes, it is induced by IL17A and regulates keratinocyte proliferation and differentiation following skin injury while inhibiting skin inflammation by suppressing inflammatory cytokines such as IL6 and TNF. In lung epithelial cells, REG-3 gamma/REG3G Protein is induced by IL22, inhibiting cytokine production and regulating allergic airway inflammation. Additionally, it is induced in the small intestine by an inulin-enriched diet and Lactobacillus gasseri-enriched microbiome, contributing to the improvement of gut barrier function, energy balance, and glucose levels. Moreover, REG-3 gamma/REG3G Protein modulates the composition of the microbiota in duodenal contents. Lastly, it is produced by nociceptors in response to endotoxins and prevents endotoxic death by targeting the kynurenine pathway in microglia.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q6UW15-1 (E27-D175)

Gene ID
Molecular Construction
N-term
REG3G (E27-D175)
Accession # Q6UW15-1
6*His
C-term
Synonyms
Regenerating islet-derived protein 3-gamma; REG-3-gamma; Pancreatitis-associated protein 1B; REG3G; PAP-1B; Regenerating islet-derived protein III-gamma
AA Sequence

EETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD

Molecular Weight

17-19 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

REG-3 gamma/REG3G Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
REG-3 gamma/REG3G Protein, Human (HEK293, His)
Cat. No.:
HY-P71256
Quantity:
MCE Japan Authorized Agent: