REG-3 beta/REG3B Protein, Mouse (HEK293, His)

REG-3 beta/REG3B Protein, a bactericidal C-type lectin, combats intestinal Gram-positive and Gram-negative bacteria, except S.typhimurium.It inhibits S.enteritidis translocation, safeguarding against infection.Beyond antibacterial action, REG-3 beta functions hormonally, activating EXTL3 receptor for cell-specific signaling.In the pancreas, it notably stimulates cell proliferation.REG-3 beta/REG3B Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 beta/REG3B protein, expressed by HEK293 , with C-His labeled tag.

REG-3 beta/REG3B, a bactericidal C-type lectin, exhibits antimicrobial properties against various intestinal Gram-positive and Gram-negative bacteria, with the exception of S.typhimurium. Its potential role in protecting against S.enteritidis infection involves inhibiting the translocation of the pathogen from the gut lumen into intestinal and extraintestinal tissues. Beyond its antibacterial function, REG-3 beta acts as a hormone in response to diverse stimuli. When secreted by different cell types, it activates its receptor EXTL3, initiating cell-specific signaling pathways. Notably, in the pancreas, REG-3 beta has the ability to stimulate cell proliferation.

Mouse

HEK293

C-His

P35230 (M1-G175)

18489  [NCBI]

MLPPTACSVMSWMLLSCLMLLSQVQGEDSLKNIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPGGHLVSVLNSAEASFLSSMVKRTGNSYQYTWIGLHDPTLGAEPNGGGWEWSNNDVMNYFNWERNPSTALDRAFCGSLSRASGFLKWRDMTCEVKLPYVCKFTG

Approximately 19 kDa

Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.