1. Recombinant Proteins
  2. Others
  3. REG-4 Protein, Human (HEK293, His)

REG-4 Protein, Human (HEK293, His)

Cat. No.: HY-P71257
SDS COA Handling Instructions

REG-4 is a calcium-independent lectin with mannose-binding specificity that retains carbohydrate recognition activity even in acidic environments. Its ability to act independently of calcium indicates its potent and versatile lectin activity. REG-4 Protein, Human (HEK293, His) is the recombinant human-derived REG-4 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $90 In-stock
50 μg $240 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

REG-4 is a calcium-independent lectin with mannose-binding specificity that retains carbohydrate recognition activity even in acidic environments. Its ability to act independently of calcium indicates its potent and versatile lectin activity. REG-4 Protein, Human (HEK293, His) is the recombinant human-derived REG-4 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

REG-4, a calcium-independent lectin, exhibits a specific affinity for mannose and retains its carbohydrate recognition activity even in acidic environments. This suggests a robust and adaptable molecular structure that may function effectively under varying physiological conditions. REG-4 is implicated in inflammatory and metaplastic responses within the gastrointestinal epithelium, indicating its potential role in the regulation of cellular processes associated with inflammation and tissue transformation. The mannose-binding specificity of REG-4 suggests its involvement in recognizing and interacting with glycoproteins or other molecules displaying mannose residues, possibly contributing to immune responses or cell signaling in the gastrointestinal context.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9BYZ8-1 (D23-P158)

Gene ID
Molecular Construction
N-term
REG-4 (D23-P158)
Accession # Q9BYZ8-1
6*His
C-term
Synonyms
Regenerating islet-derived protein 4; Gastrointestinal secretory protein; REG-like protein; Regenerating islet-derived protein IV; GISP; RELP; REG4
AA Sequence

DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP

Molecular Weight

Approximately 16.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM HIS-HCl, 5% Sucrose, 5% Mannitol, 0.05% Tween 80, pH 6.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

REG-4 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
REG-4 Protein, Human (HEK293, His)
Cat. No.:
HY-P71257
Quantity:
MCE Japan Authorized Agent: