REG-4 Protein, Human (HEK293, His)

REG-4 is a calcium-independent lectin with mannose-binding specificity that retains carbohydrate recognition activity even in acidic environments. Its ability to act independently of calcium indicates its potent and versatile lectin activity. REG-4 Protein, Human (HEK293, His) is the recombinant human-derived REG-4 protein, expressed by HEK293 , with C-6*His labeled tag.

REG-4, a calcium-independent lectin, exhibits a specific affinity for mannose and retains its carbohydrate recognition activity even in acidic environments. This suggests a robust and adaptable molecular structure that may function effectively under varying physiological conditions. REG-4 is implicated in inflammatory and metaplastic responses within the gastrointestinal epithelium, indicating its potential role in the regulation of cellular processes associated with inflammation and tissue transformation. The mannose-binding specificity of REG-4 suggests its involvement in recognizing and interacting with glycoproteins or other molecules displaying mannose residues, possibly contributing to immune responses or cell signaling in the gastrointestinal context.

Human

HEK293

C-6*His

Q9BYZ8-1 (D23-P158)

83998  [NCBI]

DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP

Approximately 16.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM HIS-HCl, 5% Sucrose, 5% Mannitol, 0.05% Tween 80, pH 6.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.