REG4 Protein, Rat (HEK293, His)

The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.

Dectin-2/CLEC6A, a calcium-dependent lectin, serves as a pattern recognition receptor (PRR) in the innate immune system, with a specific affinity for alpha-mannans present on C.albicans hyphae. Upon binding, this receptor complex triggers the phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, activating SYK, CARD9, and NF-kappa-B. This activation sequence leads to the maturation of antigen-presenting cells and shapes antigen-specific priming of T-cells towards effector T-helper 1 and T-helper 17 cell subtypes. Additionally, Dectin-2/CLEC6A recognizes allergens from house dust mite and fungi in a mannose-dependent manner, promoting cysteinyl leukotriene production. It also plays a role in altering adaptive immune responses by recognizing soluble elements from the eggs of Shistosoma mansoni. Associated with FCER1G, it forms a heterodimer with CLEC4D, creating a PRR against fungal infection.

Measured by the ability of the immobilized protein to support the adhesion of HCT-116 human colorectal carcinoma cells under low serum conditions. The ED₅₀ for this effect is 2.633 µg/mL, corresponding to a specific activity is 379.79 units/mg.

Rat

HEK293

C-6*His

Q68AX7 (D23-P157)

445583  [NCBI]

DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP

Approximately 20-31 kDa due to the glycosylation.

• 
  Measured by the ability of the immobilized protein to support the adhesion of HCT-116 human colorectal carcinoma cells under low serum conditions. The ED₅₀ for this effect is 2.633 µg/mL, corresponding to a specific activity is 379.79 units/mg.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.