Resistin Protein, Human (His)

Resistin, a hormone linking obesity to diabetes, may hinder insulin's glucose uptake stimulation in adipose cells, contributing to metabolic dysregulation. Additionally, it promotes myeloid cell chemotaxis and forms homodimers through disulfide linkages, interacting with DEFA1. Resistin's involvement in diverse cellular processes suggests its pivotal role in the complex interplay of metabolism, inflammation, and insulin responsiveness. Resistin Protein, Human (His) is the recombinant human-derived Resistin protein, expressed by E. coli , with C-6*His labeled tag.

Resistin, a hormone implicated in connecting obesity to diabetes, exerts its effects by potentially suppressing insulin's ability to stimulate glucose uptake into adipose cells. Not only does it play a role in metabolic regulation, but it also promotes chemotaxis in myeloid cells. Structurally, Resistin forms homodimers through disulfide linkages and interacts with DEFA1, indicating its involvement in diverse cellular processes. This multifaceted hormone emerges as a potential key player in the intricate interplay between metabolism, inflammation, and insulin responsiveness.

Human

E. coli

C-6*His

Q9HD89-1 (K19-P108)

56729  [NCBI]

KTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP

10-14 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Acetic acid, pH 3.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.