1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Carboxypeptidase
  4. Serine Carboxypeptidase 1
  5. RISC Protein, Mouse (HEK293, His)

RISC proteins have emerged as potential regulators of blood vessel wall and renal homeostasis, suggesting a possible role for RISC proteins in regulating key processes in these physiological environments. RISC Protein, Mouse (HEK293, His) is the recombinant mouse-derived RISC protein, expressed by HEK293 , with C-His labeled tag. The total length of RISC Protein, Mouse (HEK293, His) is 424 a.a., with molecular weight of 50-65 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RISC proteins have emerged as potential regulators of blood vessel wall and renal homeostasis, suggesting a possible role for RISC proteins in regulating key processes in these physiological environments. RISC Protein, Mouse (HEK293, His) is the recombinant mouse-derived RISC protein, expressed by HEK293 , with C-His labeled tag. The total length of RISC Protein, Mouse (HEK293, His) is 424 a.a., with molecular weight of 50-65 kDa.

Background

The RISC protein emerges as a potential player in maintaining vascular wall and kidney homeostasis, suggesting its likely involvement in regulating key processes within these physiological contexts. Although the precise mechanisms and specific functions of RISC in these tissues are yet to be fully elucidated, its association with vascular and renal homeostasis implies a role in modulating cellular functions critical for the balance and integrity of the vascular wall and kidney. The versatile nature of RISC within these contexts suggests its potential impact on diverse pathways, making it a noteworthy subject for further exploration to uncover its role in the intricate dynamics of vascular and renal physiology.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q920A5 (I29-E452)

Gene ID
Molecular Construction
N-term
RISC (I29-E452)
Accession # Q920A5
His
C-term
Synonyms
Retinoid-inducible serine carboxypeptidase; SCPEP1; RISC; SCP1
AA Sequence

IDWREPEGKEVWDYVTVRKDAHMFWWLYYATNPCKNFSELPLVMWLQGGPGGSSTGFGNFEEIGPLDTQLKPRNTTWLQWASLLFVDNPVGTGFSYVNTTDAYAKDLDTVASDMMVLLKSFFDCHKEFQTVPFYIFSESYGGKMAAGISVELYKAVQQGTIKCNFSGVALGDSWISPVDSVLSWGPYLYSMSLLDNQGLAEVSDIAEQVLDAVNKGFYKEATQLWGKAEMIIEKNTDGVNFYNILTKSSPEKAMESSLEFLRSPLVRLCQRHVRHLQGDALSQLMNGPIKKKLKIIPEDISWGAQASYVFLSMEGDFMKPAIDVVDKLLAAGVNVTVYNGQLDLIVDTIGQESWVQKLKWPQLSKFNQLKWKALYTDPKSSETAAFVKSYENLAFYWILKAGHMVPSDQGEMALKMMKLVTKQE

Molecular Weight

Approximately 50-65 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

RISC Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RISC Protein, Mouse (HEK293, His)
Cat. No.:
HY-P73674
Quantity:
MCE Japan Authorized Agent: