RNASET2 Protein, Human (HEK293, His)

The RNASET2 protein is a ribonuclease that makes a crucial contribution to the innate immune response by degrading microbial RNA sensed by TLR8. It preferentially cleaves single-stranded RNA, generating products that promote RNA-dependent TLR8 activation. RNASET2 Protein, Human (HEK293, His) is the recombinant human-derived RNASET2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of RNASET2 Protein, Human (HEK293, His) is 232 a.a., with molecular weight of 38-45 kDa.

The RNASET2 protein functions as a ribonuclease, playing a vital role in the innate immune response by recognizing and degrading RNAs from microbial pathogens, subsequently sensed by TLR8. This ribonuclease exhibits a preferential cleavage of single-stranded RNA molecules between purine and uridine residues, a process crucial for the supply of catabolic uridine and the generation of purine-2',3'-cyclophosphate-terminated oligoribonucleotides. These RNase T2 degradation products, in turn, actively promote the RNA-dependent activation of TLR8. Beyond its role in immune response, RNASET2 also plays a key role in the degradation of mitochondrial RNA and the processing of non-coding RNA imported from the cytosol into mitochondria. Additionally, it participates in the degradation of mitochondrion-associated cytosolic rRNAs, emphasizing its multifaceted involvement in RNA metabolism and immune regulation.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

C-6*His

O00584 (D25-H256)

8635  [NCBI]

DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH

38-45 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 20% Glycerol, pH 7.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.